KEGG   Trypanosoma cruzi: 511127.120Help
Entry
511127.120        CDS       T01012                                 

Definition
ubiqitin hydrolase
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
tcr  Trypanosoma cruzi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 761 aa AA seqDB search
MPDLTSIMNGREEEGNEMHVVSLRTTPASAPLFETPFILCPLVNLGNTCYFNAGVQLFAN
CIPFVYGLRNSPFRHPFLGSRALKYCRTGGKASQALFQAFAELLYDMEFARLGQGEALSP
LKALDCLAAVHPAFEGRGQQDCPEMVNVLIANLSEEGRQNVELEALLCSFEEDALTRAAS
DAVLVDVVGRDNIPNSHSTVGMDFRSMPHEHPTGVLINEETLKLCSHSVTDKEEKIEIPS
SFLFAGKPNMLSFNFPGSWWTYNTFQLMQTVNHDNEQLDRKERARKDRPQQNTFCPPKLH
YNSVTDCFTGYMLSEVQCHTCNSTSRIVEEFSSLTIDVSSYSQRMQYARRHPEARCSAEQ
RPFMQQKSRGPLQWWNPFVWIGALTRFFFSFFKGFSDYIDYPITLKECLDIHFEPVVLKG
SNSYHCASCNNVSEATKREFLLSLPEYLLLQMKRFEYGTCFNTKKTDPVIFPVSWDIGEA
GDADVLRLDDYMHESVMRNMAPSVPCRSIISTDICTDAIENMTNPMHTQQVDSPISESME
GAYTEMQSPIYTYTLENVVNHHGSIMGGHYTVYARKKTEEENVWLSLNDEEITRVGVNEV
ADSEEYLLLYKKQPLQPRSEAVLTLRRKAQSLLSLPPSDGEVLLKEEFTDRHEKRDAKGK
RVVYISRPWLQRMAFMEEPGPILNRLCYCIGEDQGHKANSRQEVEGSHNRICRMSHGPPV
EWFYVPLRCDEYDAFYKMYGGNTALTQREYEELYEAQHQVA
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgccagatcttacatcgataatgaacgggagggaggaagaggggaatgagatgcatgtt
gtttcattgcgaactacgcctgcatccgcacccctctttgagactccattcattctctgt
cctttagtaaatttgggtaacacatgttactttaacgctggtgtgcagctttttgcgaac
tgtatcccatttgtatacggtctgaggaattctccatttcggcatcccttccttggctcc
cgcgccctgaagtactgtcgtactggaggaaaggcttcccaagcattgtttcaggccttt
gcagaacttttatatgacatggaatttgcacgacttgggcagggtgaggctctttcgcca
ctgaaggcgctagactgcttggcggctgttcaccctgcctttgagggtcgtggtcaacag
gactgcccagagatggtgaatgtcctcattgccaacctgtcagaggagggaagacaaaat
gtggagttggaagcgttattgtgttcctttgaagaagatgccctcacacgtgcggcttct
gatgctgtgttagtggatgttgtcggtcgtgacaatatacccaactcacactccaccgtg
ggtatggattttcgatctatgccgcatgagcatcccactggggtactcattaatgaagag
acgttaaaactatgcagtcattctgtaacggataaagaagaaaaaattgagataccgtca
tcgtttctctttgctgggaaacccaatatgctgtcctttaattttccaggtagctggtgg
acctacaatacgtttcaactcatgcaaacagtgaaccatgacaatgagcagcttgatcgc
aaagagagggccaggaaggataggccacaacagaatacattttgtccaccaaagttacac
tataacagtgtgacggattgttttactgggtatatgttatcggaggttcagtgtcataca
tgtaatagcacctcccgtatcgttgaggaattttcttctcttaccattgatgtttcatct
tacagccaacgcatgcagtatgcccggagacatccagaagcgcgatgttccgcggagcaa
cgacctttcatgcaacagaagagccgtgggccgcttcaatggtggaacccgtttgtttgg
attggtgcattgacccgttttttctttagcttctttaagggtttttcagattacattgat
taccccatcaccttgaaggagtgccttgatattcacttcgagcctgtggtcctgaaggga
agtaacagttatcattgtgcctcgtgcaataacgtatcggaagccactaaacgcgaattt
cttctctcccttccagagtatttacttctgcagatgaaacgctttgaatatgggacgtgt
tttaatacaaaaaaaacggatcctgttatatttcccgtctcttgggatattggagaagct
ggtgatgcagatgtgctgcgtcttgatgattacatgcatgagagcgtcatgagaaatatg
gcaccttccgtaccgtgtcggtccattataagcacagacatttgtacagatgcaatagag
aacatgacgaatccaatgcatacgcaacaagtagatagccctatcagtgagagtatggaa
ggggcatacacggagatgcagtctccgatttacacgtacacattagaaaatgttgtgaat
catcatggatctatcatgggtgggcactatacggtctacgcacgcaaaaaaacggaggag
gaaaatgtatggttgtctttaaatgacgaggaaatcactcgtgtgggtgtcaatgaggtt
gccgattcagaagaatatcttttgctttacaagaaacagccacttcaaccccgctcagaa
gctgttctgacgctccgtcgcaaggcgcaaagcctcctttcgctcccaccgtccgatggg
gaagtattactgaaggaagaattcacagacaggcatgaaaagagggatgcaaaaggaaag
agggtggtgtatatttcccgcccttggttacaacggatggctttcatggaggagccaggg
cccattcttaatcgactatgctactgtataggagaggatcaaggccacaaggcaaactcg
aggcaagaagtggaaggatcacataatcggatatgccgaatgagccatggtcctcctgtg
gagtggttttatgtcccgttacggtgtgacgagtatgatgccttctataaaatgtacgga
ggcaatacggcactgacgcagagggagtatgaagaattgtatgaggctcagcatcaagta
gcatag

DBGET integrated database retrieval system