KEGG   Trypanosoma cruzi: 511153.64Help
Entry
511153.64         CDS       T01012                                 

Definition
(RefSeq) histone H2B variant
  KO
K11252  histone H2B
Organism
tcr  Trypanosoma cruzi
Brite
Chromosome and associated proteins [BR:tcr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    511153.64
Exosome [BR:tcr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   511153.64
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 3545222
NCBI-ProteinID: XP_813772
GeneDB: Tc00.1047053511153.64
UniProt: Q4DHB9
AA seq 143 aa AA seqDB search
MPPTKGGKRPLPMGGKGKGKRPASATRKASGGKKKGGARRGKKQRRWDLYIHRTLRQVYK
RGTLSKAAVRVLSSFIEDMYSKIQSEAVHVACINNVKTLTAREIQTSARLLLPPELAKHA
MSEGTKAVAKYNASREEAYAKAV
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaacaaagggagggaagcggcctcttcccatgggcgggaaaggcaaaggaaag
cgacctgcaagcgccacgcggaaggcttcgggcggtaagaagaaggggggcgctcgccga
gggaaaaagcagcggcggtgggatctgtacatccacaggaccttgcgtcaagtgtacaag
cgtgggacgctttccaaggcggccgtgcgtgtgctttcgtcctttattgaggacatgtac
agcaagattcagagcgaagcagttcatgtggcatgcataaacaacgtgaagacactgacg
gcacgtgaaattcaaacatctgctcgtctgcttctgccgccagaactcgccaagcatgca
atgagcgagggcacaaaggctgttgccaaatataacgcttcacgcgaagaggcctacgcg
aaggcggtgtag

DBGET integrated database retrieval system