KEGG   Trypanosoma cruzi: 511153.64Help
Entry
511153.64         CDS       T01012                                 

Definition
histone H2B variant
Orthology
K11252  
histone H2B
Organism
tcr  Trypanosoma cruzi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 143 aa AA seqDB search
MPPTKGGKRPLPMGGKGKGKRPASATRKASGGKKKGGARRGKKQRRWDLYIHRTLRQVYK
RGTLSKAAVRVLSSFIEDMYSKIQSEAVHVACINNVKTLTAREIQTSARLLLPPELAKHA
MSEGTKAVAKYNASREEAYAKAV
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaacaaagggagggaagcggcctcttcccatgggcgggaaaggcaaaggaaag
cgacctgcaagcgccacgcggaaggcttcgggcggtaagaagaaggggggcgctcgccga
gggaaaaagcagcggcggtgggatctgtacatccacaggaccttgcgtcaagtgtacaag
cgtgggacgctttccaaggcggccgtgcgtgtgctttcgtcctttattgaggacatgtac
agcaagattcagagcgaagcagttcatgtggcatgcataaacaacgtgaagacactgacg
gcacgtgaaattcaaacatctgctcgtctgcttctgccgccagaactcgccaagcatgca
atgagcgagggcacaaaggctgttgccaaatataacgcttcacgcgaagaggcctacgcg
aaggcggtgtag

DBGET integrated database retrieval system