KEGG   Trypanosoma cruzi: 511269.50Help
Entry
511269.50         CDS       T01012                                 

Definition
protein kinase A catalytic subunit (EC:2.7.1.37)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     511269.50
Protein kinases [BR:tcr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   511269.50
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 337 aa AA seqDB search
MKAGTTVTKEEVAEWQLHDLELGETIGTGTFGRVRLCKHKTSGKYMALKILKKQEVLRMK
QVEHILAESSILQELNHPFIVNMLKGFMDNDRLYILLEYVVGGELFTHLRKAGKFPNDVA
KFYSAEVILAFEYLHNCNIVYRDLKPENLLLDAQGNIKITDFGFAKRVTERTFTLCGTPE
YLAPEVIQSRGHNKAVDWWALGILLYEMLVGYPPFFDESPFKIYEKILEGKLQFPRWVEA
RAKDLIKGLLVLEPTKRLGSLNRGTQDVKRHKFYSGVDWDILLQKKVTPPIPVRLNKEGD
TRYFDRYPESPRHPLPPLTAKQQEMFAGFCDGEYTKA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctggtacgaccgttacaaaggaggaggtggccgaatggcagcttcatgattta
gagttaggcgaaacgataggcactggaacctttggtcgtgttcgcctttgtaagcacaaa
acatctgggaaatatatggcgctaaaaattctcaaaaagcaggaggtgctgcgcatgaag
caagtggaacatattttggcagagtcaagtattttacaggagcttaatcatccctttatc
gtaaacatgctcaagggctttatggacaatgaccgtttgtacattcttcttgagtacgtg
gtaggtggtgagcttttcacgcatctgcgaaaagccggaaaatttcccaatgatgtcgca
aagttttattctgcagaagtgattttagcatttgagtatcttcacaactgcaacatcgtg
taccgcgacctaaaaccggaaaatctgttattggatgcacaaggaaacattaaaatcacc
gactttgggtttgccaagcgtgtgaccgaacgcacgtttacgttgtgcggcaccccagag
tatctggctccggaagtcattcaaagcagaggccacaataaagctgtggattggtgggcg
cttggcattttattgtatgaaatgctggttggttatccgccgttttttgatgagagtccc
tttaaaatatatgaaaagattctggagggcaagctgcaatttccgcgttgggttgaggca
cgggcgaaggatcttatcaagggtctgctggtgcttgagcccacaaagcgccttggctcg
ctgaatcgtggcacccaagacgttaagcgacacaaattttatagcggagtagattgggat
atacttttacagaaaaaggtaacaccgcccattcctgtgcggctaaataaggaaggggat
acgcgctactttgaccgctatccagagagtccccgccatccgttgccacctctgacggca
aaacaacaagagatgtttgcagggttttgtgacggagagtataccaaagcgtaa

DBGET integrated database retrieval system