KEGG   Trypanosoma cruzi: 511353.40Help
Entry
511353.40         CDS       T01012                                 

Definition
eukaryotic translation initiation factor 4E (eIF4E) interacting protein
Orthology
K03259  
translation initiation factor 4E
Organism
tcr  Trypanosoma cruzi
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    511353.40
Translation factors [BR:tcr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    511353.40
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 250 aa AA seqDB search
MQTRLKSRPDEPKLAVHPTSCITPLWGVWEMWCVLPDPVGGAVGNNTGVRGSAVKKGCAV
HKEGNRATWLDQVRSIGLFDNAEGFWGIATCTLPPSQLPPGITYYMLRRNIAPMWEHEAN
RRGGRWVVRFQDQQHRQQRKGENEEEITEDRSSQVDEAWESLCIALIGEQLPCPETEVCG
VALRRAERRREWKLSLWTRTAADRETQLCIGRFMKTLLNLEDGVLQYLSHRELMQASKEG
CWKVPPKYEL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgcggctgaagtcgcggccagatgagcccaaattagccgtgcacccaaccagc
tgcattaccccgctctggggcgtgtgggagatgtggtgtgttctgccagatcctgtgggt
ggggcggttggtaacaatacgggtgttcgaggcagcgccgtaaagaaggggtgcgcggtg
cataaagaggggaatagagcgacatggctagatcaggtgcgtagcatcggtctttttgat
aacgctgaagggttctggggaattgccacgtgcacattgccgccctcacagttgccgccc
ggcatcacgtattacatgctccggcgcaacattgctcccatgtgggaacatgaggccaac
cggcgaggaggccgctgggtggttcgattccaggatcaacaacatcgccagcaaaggaaa
ggggaaaacgaagaagaaataactgaggatcggtcatctcaggttgatgaggcctgggaa
agtctgtgcattgcgttgattggagaacagcttccatgcccagagacagaggtctgcggt
gtggcgctgcggcgggcagaacgacgtcgagaatggaagctgagtttgtggacacgcaca
gccgctgaccgtgagacgcagttgtgtattggccgcttcatgaaaaccttactgaattta
gaggacggcgtccttcagtacctgtcgcaccgcgagctaatgcaggcaagtaaggaggga
tgctggaaggtaccacccaaatacgagttatag

DBGET integrated database retrieval system