KEGG   Trypanosoma cruzi: 511353.40Help
Entry
511353.40         CDS       T01012                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E (eIF4E) interacting protein
  KO
K03259  translation initiation factor 4E
Organism
tcr  Trypanosoma cruzi
Pathway
tcr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    511353.40
Messenger RNA biogenesis [BR:tcr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     511353.40
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     511353.40
Translation factors [BR:tcr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    511353.40
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 3537833
NCBI-ProteinID: XP_807581
GeneDB: Tc00.1047053511353.40
UniProt: Q4CZM8
AA seq 250 aa AA seqDB search
MQTRLKSRPDEPKLAVHPTSCITPLWGVWEMWCVLPDPVGGAVGNNTGVRGSAVKKGCAV
HKEGNRATWLDQVRSIGLFDNAEGFWGIATCTLPPSQLPPGITYYMLRRNIAPMWEHEAN
RRGGRWVVRFQDQQHRQQRKGENEEEITEDRSSQVDEAWESLCIALIGEQLPCPETEVCG
VALRRAERRREWKLSLWTRTAADRETQLCIGRFMKTLLNLEDGVLQYLSHRELMQASKEG
CWKVPPKYEL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgcggctgaagtcgcggccagatgagcccaaattagccgtgcacccaaccagc
tgcattaccccgctctggggcgtgtgggagatgtggtgtgttctgccagatcctgtgggt
ggggcggttggtaacaatacgggtgttcgaggcagcgccgtaaagaaggggtgcgcggtg
cataaagaggggaatagagcgacatggctagatcaggtgcgtagcatcggtctttttgat
aacgctgaagggttctggggaattgccacgtgcacattgccgccctcacagttgccgccc
ggcatcacgtattacatgctccggcgcaacattgctcccatgtgggaacatgaggccaac
cggcgaggaggccgctgggtggttcgattccaggatcaacaacatcgccagcaaaggaaa
ggggaaaacgaagaagaaataactgaggatcggtcatctcaggttgatgaggcctgggaa
agtctgtgcattgcgttgattggagaacagcttccatgcccagagacagaggtctgcggt
gtggcgctgcggcgggcagaacgacgtcgagaatggaagctgagtttgtggacacgcaca
gccgctgaccgtgagacgcagttgtgtattggccgcttcatgaaaaccttactgaattta
gaggacggcgtccttcagtacctgtcgcaccgcgagctaatgcaggcaagtaaggaggga
tgctggaaggtaccacccaaatacgagttatag

DBGET integrated database retrieval system