KEGG   Trypanosoma cruzi: 511367.260Help
Entry
511367.260        CDS       T01012                                 

Definition
ubiquitin hydrolase
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     511367.260
Peptidases [BR:tcr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   511367.260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 655 aa AA seqDB search
MGVNSSKGGKLKRELSPQNEPIHSLHARGISLTSEAELSVSVPKIRPLPLKIDTTSNHNG
SSSSVGEAGGGDARKNGINGTSGKGAAEALFTSPECSCNPTDNLRPPLSPKNLFCPTSPI
PTYSSELSVALPSTPMLRSYRLHSFSQQESTLSSPLSPGLSSPPIHTRFLEINGYPAGLE
NYGNTCYCNAVIQLLYHCSPLRLRLLELYQIYAKGAGHTGFEEDTLLALVVDLFAKMHKA
NNQKRYRKDAIAPKALISSIKEQNAAFNNTLQQDAHEFTMFLLSKMIETEKRMMGDEKNR
ALFFGAKKGKGPKWWNVLRRGRKRDGSWQATGVGEVQEEDVELPPALRDGNDVPRPANAP
SGSGDASDARMAATFTAAAAAATRTTTAAEADWSAVSPIQVIFGGQFASLTACFECERTK
TTREVFLDLSLDIEQGSSLLRCVSNFGSPELFYGANKLHCEHCKKHVVAQKLLRVHRLPE
YALLVHLKRFEYNEKTGKLTKRSDHVAVPNEIDVVEYEPWDDSNGASKTGVSECDSHAPC
PPGSPSVAVEARTVAEGEDEASAPRPSVHLMNKLDGVVHRKGRFALSGFVTHLGEGPDVG
HYFTCVRHGGRWCLFNDATVTELTEYEVQKFWGVPIPVSGVVTATAYILLYERVA
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaatagttcaaagggaggcaaactgaaaagggagttatccccgcagaatgag
ccgattcactcactccatgcgcgtggcatttcattaacgtcagaggcggaattaagcgtc
tccgttccaaaaatacggcctcttccactgaagattgacaccaccagcaatcataacggc
agtagcagtagtgttggtgaggctgggggcggcgatgcacgtaagaatggcatcaatggg
accagcggtaaaggtgccgcggaggctttattcacgtcgccggagtgttcatgcaacccg
accgataacttgcgtccaccactgtcacctaaaaatttattttgcccgacatcgccgatt
ccaacgtacagcagcgagttgtcggtcgccctgccctccaccccgatgttgcgctcgtac
cgactgcactccttttcccagcaggagagtaccctgtccagtcccctttccccaggcctg
tcatccccacccattcatacgcgcttcttggaaattaacggatacccagctgggttagag
aactacggtaacacatgctactgcaacgccgttattcagctcctctaccactgttccccg
ctacggctgcggctgctggagttgtatcagatatacgccaaaggcgcgggacacactggc
tttgaggaagacacactacttgcgcttgtagtggatttgtttgcaaagatgcacaaggca
aataatcaaaagaggtatcgaaaggatgccattgcaccaaaagcacttatttccagtata
aaagaacaaaatgcagcttttaataatactcttcagcaagatgcccatgagtttacgatg
tttttgttgtcgaagatgatagaaacggagaagcgcatgatgggggatgagaaaaatcgt
gcacttttctttggtgcaaaaaagggcaagggaccaaagtggtggaatgtgttacgtcgg
ggtcgaaaacgggatggttcctggcaagcgacgggtgtaggggaagtgcaggaggaggat
gtggagctaccgcccgctctccgtgatggaaatgacgtaccacgaccagcgaacgcacca
agcggaagtggtgatgcatcggatgcgcgtatggcggcaacctttacagctgctgctgct
gccgcaacaagaacaacaacggctgcagaagccgattggagtgctgtgtcacccattcaa
gtgatatttggtggtcagtttgcttcgctgacggcgtgttttgagtgtgagcggacgaaa
acgactcgggaggtctttttggacctcagtcttgacattgagcagggatcctcgctgctg
cgctgcgtgtcgaactttggctcaccagagttgttttatggggcgaacaagttgcattgt
gaacattgcaaaaagcatgtggttgcacagaaattgcttcgcgtgcatcgactgccggag
tatgcactgttggtgcacttgaagcggtttgaatacaacgagaagacgggcaagctaacg
aagcgaagtgaccacgtcgccgtcccaaatgaaattgatgtggtggagtacgagccctgg
gatgacagcaatggcgccagcaagactggcgtctcggagtgcgactcacatgccccgtgt
cctccaggttctccgtcagtggcggttgaggcacgcacagtggcggagggcgaggatgaa
gccagcgccccacgtccctcagtacacctgatgaacaagttggatggcgtggtgcaccgc
aagggacgctttgcgctgagtggttttgtaacgcatttgggggagggccctgatgttggc
cactatttcacatgcgtgcggcacgggggacgttggtgcctcttcaatgacgccactgtg
acggagctgacggaatatgaggtgcaaaagttctggggggtaccgatccctgtgagtggg
gtggtcactgcaacggcgtacatcctcctgtacgagcgtgttgcgtga

DBGET integrated database retrieval system