KEGG   Trypanosoma cruzi: 511367.70Help
Entry
511367.70         CDS       T01012                                 

Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    511367.70
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    511367.70
   00020 Citrate cycle (TCA cycle)
    511367.70
   00620 Pyruvate metabolism
    511367.70
Enzymes [BR:tcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     511367.70
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 269 aa AA seqDB search
MRRSFLFLVNFSPLFMPALSPSMETGTIVEWKKKVGDLVNENEVFCTVQTDKAVVDYTNT
FDAGYLAKILCHSGETVPVAKTIAVMVEDEADIPKIADYRPEGEAPGEEVKSDAPAVPSP
AAPAPTAPPSGGKRYGESLEDTIAASGPAVLRIAARLDRKTLESLPFTGKGGRFAKCDFV
GQPGFNDDDVPPPPAPSPPPSAASAAVSAKNSGATRVNKATAGAAPGGSVVGKAFPVCNL
KVSDTTLLQQLIRTMPLPKKTASAANNKQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgatcatttttatttctggtgaatttctcgccgctcttcatgccggcactgtcg
ccctcgatggagacgggcaccattgtggagtggaagaagaaagtcggcgacctcgtcaat
gagaacgaggtgttctgcaccgtgcagaccgacaaggcggtcgtggactacacgaacacg
tttgatgccgggtacctcgcaaagatcctttgtcacagcggggagacggtgcctgttgca
aagaccatcgccgtcatggttgaggacgaagcagacatcccaaaaatagcagactatcgc
cccgagggcgaagcaccgggcgaggaggtcaagtccgacgcacccgccgtgccatctcct
gccgcccccgcacccaccgcgccgccttcggggggcaaacgatacggggagtcgctggag
gacacaattgcagcgagtgggcctgccgtcttacgtatcgccgcgcggctggaccgcaag
acgctggagtcgctcccattcaccggcaaaggcgggcgatttgcaaagtgcgacttcgtg
gggcaaccggggttcaacgacgacgatgtgccaccgcccccagcaccttcaccaccgccg
tctgccgcttctgctgccgtctccgcgaagaatagcggcgccactcgagtgaataaggcc
acagcaggagcggcgcccggcggcagcgtcgtggggaaggcgttccctgtgtgcaacctg
aaggtcagtgacacgacactcctgcagcagctcattcgtacgatgccgctgccaaagaaa
actgccagcgcggcaaataacaaacaataa

DBGET integrated database retrieval system