KEGG   Trypanosoma cruzi: 511529.160Help
Entry
511529.160        CDS       T01012                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase family protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00280  Valine, leucine and isoleucine degradation
tcr00410  beta-Alanine metabolism
tcr00640  Propanoate metabolism
tcr01100  Metabolic pathways
tcr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    511529.160
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    511529.160
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    511529.160
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     511529.160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 3547498
NCBI-ProteinID: XP_815734
GeneDB: Tc00.1047053511529.160
UniProt: Q4DMX9
AA seq 362 aa AA seqDB search
MRRTIRVFTGKLLWEDFTNTRLITINREKALNSMDLEMVKAMQRAYVHEPHAKGDSALFV
VKGAGNKSFCAGGDIVSLKDRYDVAAEFFYTEYQMNYHILTMPNPQVSLWDGYVMGGGVG
VSVHGRYRVASERAVFAMPETAIGLFPDVGASWFLPRLKMKGLGLYLGLTGARLKGADVA
HTGLATHYVPSARFCELEERLCHIDDPAKVEACLEEFAVRDLPPFTLEPHRETIEKSFAL
EEKTTVEGIYESLSADGGEFAKGTINTLNRMAPTSLRVSLEMQKRGVKMTDPADVFRMDY
IGSLRTHANSDFHEGVRALLVDKTKDPKWKPAKLSDVTADYVEAYFKPMGNQARQWHPTV
PY
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgaacaatacgggttttcacgggtaaattgttgtgggaggacttcaccaatact
cgtcttatcactataaatcgtgagaaggctctgaactctatggatttggaaatggtgaaa
gccatgcaacgggcgtatgttcatgagccacacgccaagggggactctgcgctttttgtt
gtcaagggtgcaggcaacaagagtttttgcgctggtggagatatcgtcagtctcaaagac
aggtatgacgttgctgcggagtttttttatacggaatatcaaatgaactatcacatactt
accatgccgaacccgcaggtctccctgtgggatggctacgtcatgggtggaggcgtcggt
gtttctgtccatgggcgatatcgcgtggcgtcggagcgtgccgtctttgcaatgcctgaa
acggccattggtctctttccagatgtgggggcgtcgtggtttctgcctcgtctaaagatg
aagggacttggcctgtatcttggtctcacaggagctaggctgaagggggccgatgtggca
cacacgggtcttgcaacgcattacgtcccgtcagcccgcttttgtgagttggaggaacgc
ctgtgccacattgacgatcctgcgaaggtggaggcatgcctggaggagtttgctgtgagg
gatttgccaccgtttacgcttgagccccaccgtgagaccattgagaagagctttgcattg
gaggaaaaaaccaccgtggagggcatatatgagtctctctctgctgacggtggggaattt
gcaaagggtaccataaacacgttgaaccgaatggcacccacatctctccgcgtgtcccta
gagatgcagaagaggggcgtgaaaatgacagatcccgcagacgtgtttcgaatggattac
attgggtctctgaggacccatgccaattcggactttcatgaaggggtgagggcactgctt
gttgacaagacaaaggatcccaagtggaagccggccaagctttccgacgtcactgcggat
tatgtggaggcgtactttaagcctatggggaatcaagctcgccagtggcatccgaccgtg
ccgtactaa

DBGET integrated database retrieval system