KEGG   Trypanosoma cruzi: 511635.20Help
Entry
511635.20         CDS       T01012                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
tcr  Trypanosoma cruzi
Brite
Exosome [BR:tcr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   511635.20
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 112 aa AA seqDB search
MATPKSSSANRKKGGKRSHRNPKRTWNVYISRSLKSINNHMSMSGRTMKIVNSFVNDLFE
RIASEAATVVRVNKKRTLGARELQTAVRLVLPADLAKHAMAEGTKAVSHASS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggccacccccaagagctcgtcggcgaaccgcaaaaagggcggcaagaggtcgcaccgc
aatccgaagcggacgtggaatgtctacatcagccgctcgctcaagtcgatcaacaaccat
atgtcgatgtccggccggacgatgaagattgtgaactcgttcgtgaacgacctctttgag
cgcattgcgtccgaggccgccacggtggtgcgcgtcaacaagaagcgcacactgggtgca
cgcgagctgcagacggcggtgcgcctcgtgctgccggcggacctggcgaagcacgcaatg
gcggagggcaccaaggcggtgtcgcacgcctctagttag

DBGET integrated database retrieval system