KEGG   Trypanosoma cruzi: 511643.30Help
Entry
511643.30         CDS       T01012                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tcr  Trypanosoma cruzi
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    511643.30
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    511643.30
Enzymes [BR:tcr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     511643.30
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 327 aa AA seqDB search
MLELPPVTSLKGKSITSAEQFSRADIYALIHLASAMQRKIDAGEVVNLLQGRIMTPLFFE
DSSRTFSSFCAAMIRLGGSVVNFKVEASSINKGETLADTIRTVDAYSDVLVMRHPRQDAI
EEALSVAQHPILNAGNGAGEHPTQALLDTLTIHSELGSVDGITIALIGDLKMGRTVHSLF
KLLVRNFSIKCVFLVAPDALQMPQDVLESLQHEIATKGVIIHRTHALTDEVMQTSDVLYT
TRLQKERFMASTSDDAAALQSFAAAKADITIDAARMRLAKEKMIVMHPLPRNDELSTTVD
TDPRAAYFRQMRYGMFMRMAILWSVLA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttggaactgccgccagtaacgagcctgaagggcaaaagcatcacaagtgccgagcag
ttcagtcgtgcggatatctacgcgctgattcatcttgcaagcgccatgcagcgtaagatt
gatgcgggcgaggtggtgaatctcctgcagggccgcatcatgacgccacttttttttgag
gattcctctcgcaccttcagttccttttgtgccgcgatgattcgacttggtgggagcgtg
gtgaactttaaggtcgaggcgtcatccatcaacaagggcgagaccctcgccgacaccatt
cgcacagtggacgcctacagcgacgtgctggtgatgcggcatccaaggcaggacgcgatt
gaagaggccctctccgtggcgcagcatcccattctgaatgcgggcaatggggctggcgaa
cacccaacgcaggcgcttctggacacgctgacgattcattcggaattgggcagcgtagac
ggcatcaccatcgcgctgatcggagacctgaagatggggcgaacggtgcactctcttttt
aagcttcttgtgcgcaacttttctattaaatgtgtgtttcttgtcgccccggacgcactg
cagatgccgcaggatgtgctggaatccctgcaacacgagatcgccacgaagggagtgata
attcaccgcacacacgcactgacagatgaggtcatgcaaacgagtgatgtgttgtacaca
acgcgtctgcagaaggaacggtttatggcttccacgagcgatgatgcggcggcgttgcag
tcatttgcggcggcgaaagccgacatcaccatcgacgcggcacgtatgaggctggcgaag
gaaaaaatgattgttatgcatccgctgccgcgcaatgacgagttaagcactaccgttgac
acagacccacgtgctgcctactttagacaaatgcggtacggcatgtttatgcgcatggcc
attttgtggagcgttttggcgtga

DBGET integrated database retrieval system