KEGG   Trypanosoma cruzi: 511817.40Help
Entry
511817.40         CDS       T01012                                 

Definition
NADH-cytochrome B5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tcr  Trypanosoma cruzi
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tcr00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 288 aa AA seqDB search
MKALFAAAATGFASSFCYNRELATCSAAKSPFSTTEFRPFTLMNFYDESHNTRVFRFALP
EADMPLNLEVSSCITAKYTGKNGEAVIRPYTPINKSDQRGYFEILVKRYDNSKMTTHLFS
LKKGDTLEFKGPWVKIPIKANQYRHIGMIAGGTGITPMYQVARNVLRVPKNTTAISLIYA
NTRKEDVLLGNELNELMETCPLFSPYYVLSQAPSDWMGGVGYVNKEMIKSVMPPPSSAAD
SIILVCGPPPFMEAISGDKDFKTSPPSQGELKGMLKELGYMQKMVFKF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttatttgcggcggccgccaccggatttgcctcttcattttgttataatcga
gagcttgcgacctgttcagctgcaaagagtccattttctaccacagagtttcgtccgttt
acattaatgaatttttatgatgaatcacacaatacaagagtttttcgttttgctcttcca
gaagctgatatgcccttgaatctggaagtttcttcctgtatcacagcgaagtatactgga
aagaatggagaggcggttattcgtccctatacaccaattaataagagtgatcaacgcggc
tattttgaaattcttgtgaaacgctacgataactccaagatgacaacacaccttttttct
ctgaagaaaggtgacactttggaatttaaaggaccatgggtaaagattccgattaaggcg
aaccaatacaggcatattggcatgattgcaggagggacaggaattactccaatgtatcag
gtggcccgtaatgtcttgcgtgtgcctaagaacacgacggccatttctctgatttatgct
aatactcgcaaggaggatgttcttttgggaaatgaactcaatgagcttatggaaacgtgt
cctctcttttcaccttactatgttctttcccaggctccttcggattggatgggaggtgta
ggatatgtgaacaaggagatgattaaatcggtcatgccgccaccaagcagtgcagctgat
tccataatccttgtatgcggaccgcccccttttatggaggctatttcaggcgacaaggac
tttaagactagtccaccctctcaaggtgagctgaaaggcatgcttaaagaacttggttac
atgcagaagatggttttcaagttctga

DBGET integrated database retrieval system