KEGG   Trypanosoma cruzi: 511817.40Help
Entry
511817.40         CDS       T01012                                 

Definition
(RefSeq) NADH-cytochrome B5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    511817.40
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     511817.40
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 3551793
NCBI-ProteinID: XP_819351
GeneDB: Tc00.1047053511817.40
UniProt: Q4DYC3
AA seq 288 aa AA seqDB search
MKALFAAAATGFASSFCYNRELATCSAAKSPFSTTEFRPFTLMNFYDESHNTRVFRFALP
EADMPLNLEVSSCITAKYTGKNGEAVIRPYTPINKSDQRGYFEILVKRYDNSKMTTHLFS
LKKGDTLEFKGPWVKIPIKANQYRHIGMIAGGTGITPMYQVARNVLRVPKNTTAISLIYA
NTRKEDVLLGNELNELMETCPLFSPYYVLSQAPSDWMGGVGYVNKEMIKSVMPPPSSAAD
SIILVCGPPPFMEAISGDKDFKTSPPSQGELKGMLKELGYMQKMVFKF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttatttgcggcggccgccaccggatttgcctcttcattttgttataatcga
gagcttgcgacctgttcagctgcaaagagtccattttctaccacagagtttcgtccgttt
acattaatgaatttttatgatgaatcacacaatacaagagtttttcgttttgctcttcca
gaagctgatatgcccttgaatctggaagtttcttcctgtatcacagcgaagtatactgga
aagaatggagaggcggttattcgtccctatacaccaattaataagagtgatcaacgcggc
tattttgaaattcttgtgaaacgctacgataactccaagatgacaacacaccttttttct
ctgaagaaaggtgacactttggaatttaaaggaccatgggtaaagattccgattaaggcg
aaccaatacaggcatattggcatgattgcaggagggacaggaattactccaatgtatcag
gtggcccgtaatgtcttgcgtgtgcctaagaacacgacggccatttctctgatttatgct
aatactcgcaaggaggatgttcttttgggaaatgaactcaatgagcttatggaaacgtgt
cctctcttttcaccttactatgttctttcccaggctccttcggattggatgggaggtgta
ggatatgtgaacaaggagatgattaaatcggtcatgccgccaccaagcagtgcagctgat
tccataatccttgtatgcggaccgcccccttttatggaggctatttcaggcgacaaggac
tttaagactagtccaccctctcaaggtgagctgaaaggcatgcttaaagaacttggttac
atgcagaagatggttttcaagttctga

DBGET integrated database retrieval system