KEGG   Trypanosoma cruzi: 511907.50Help
Entry
511907.50         CDS       T01012                                 

Definition
lysophospholipase
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    511907.50
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     511907.50
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 281 aa AA seqDB search
MIGTPIENLTVSQIKEELRTFYGIRDFSDVVELKDLQAKLTTTRNSQLITHGLQYGPLLQ
VGNRKNPNGVVTLLHGLGDSAHGWEPVAHELAGSLPHLLFLLPTAPVRPVTINGGMSMNA
WYDIKEISAATDVSRQDGETVMISAEYVKSLAYTTTQRYCIPKNRVVYAGFSQGAAVSLA
AGITSRIAPAGVAVLSGYLAGGNVVLSRLCNKEIPILMCHGTEDGIVPFEAAQQTKKALE
SAGVASITLKSYRMEHSSHPDEIRDVVSFLKKVLPAIDSKA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaacgccgatagaaaacttgaccgtctcacagattaaggaggagctacggacg
ttctacggcatcagggacttctcggatgtcgtggaattgaaggacctgcaagccaaactt
accacaacaagaaactcgcagctcataacgcatggcctgcaatacggtccattgctgcag
gttgggaaccgaaagaatccaaacggtgttgtgactcttttgcatggactgggggattcg
gcgcatggctgggagcctgtcgcgcatgagttggcgggttccctgccgcacttgttgttt
cttcttccgacggctccggttcggccggtgaccattaacggtggtatgtcgatgaatgcg
tggtacgacatcaaggagatctctgctgccacagacgtttcgcgtcaagatggagagacg
gtgatgatctccgctgaatacgtcaagagtctcgcgtacactacgacgcagcgctactgc
attccgaagaaccgtgttgtgtatgcaggcttctcgcaaggcgcagcggtatcacttgcg
gcggggatcacctcacgtattgcaccggcaggtgtggcggtactctctggatatctcgct
ggcggcaacgtggtcctctctcgtctgtgcaacaaggagattcccattcttatgtgtcac
ggcacggaggacggaattgtgccctttgaagcggcacaacagacaaagaaggcactggag
tcggctggggttgcgtccatcacactgaagtcctaccgaatggagcactcatcgcaccct
gacgagatccgtgacgttgtgagtttcctgaagaaggtgttgccggcgattgactccaag
gcctag

DBGET integrated database retrieval system