KEGG   Trypanosoma cruzi: 511907.50Help
Entry
511907.50         CDS       T01012                                 

Definition
lysophospholipase
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tcr00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 281 aa AA seqDB search
MIGTPIENLTVSQIKEELRTFYGIRDFSDVVELKDLQAKLTTTRNSQLITHGLQYGPLLQ
VGNRKNPNGVVTLLHGLGDSAHGWEPVAHELAGSLPHLLFLLPTAPVRPVTINGGMSMNA
WYDIKEISAATDVSRQDGETVMISAEYVKSLAYTTTQRYCIPKNRVVYAGFSQGAAVSLA
AGITSRIAPAGVAVLSGYLAGGNVVLSRLCNKEIPILMCHGTEDGIVPFEAAQQTKKALE
SAGVASITLKSYRMEHSSHPDEIRDVVSFLKKVLPAIDSKA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaacgccgatagaaaacttgaccgtctcacagattaaggaggagctacggacg
ttctacggcatcagggacttctcggatgtcgtggaattgaaggacctgcaagccaaactt
accacaacaagaaactcgcagctcataacgcatggcctgcaatacggtccattgctgcag
gttgggaaccgaaagaatccaaacggtgttgtgactcttttgcatggactgggggattcg
gcgcatggctgggagcctgtcgcgcatgagttggcgggttccctgccgcacttgttgttt
cttcttccgacggctccggttcggccggtgaccattaacggtggtatgtcgatgaatgcg
tggtacgacatcaaggagatctctgctgccacagacgtttcgcgtcaagatggagagacg
gtgatgatctccgctgaatacgtcaagagtctcgcgtacactacgacgcagcgctactgc
attccgaagaaccgtgttgtgtatgcaggcttctcgcaaggcgcagcggtatcacttgcg
gcggggatcacctcacgtattgcaccggcaggtgtggcggtactctctggatatctcgct
ggcggcaacgtggtcctctctcgtctgtgcaacaaggagattcccattcttatgtgtcac
ggcacggaggacggaattgtgccctttgaagcggcacaacagacaaagaaggcactggag
tcggctggggttgcgtccatcacactgaagtcctaccgaatggagcactcatcgcaccct
gacgagatccgtgacgttgtgagtttcctgaagaaggtgttgccggcgattgactccaag
gcctag

DBGET integrated database retrieval system