KEGG   Trypanosoma cruzi: 511911.159Help
Entry
511911.159        CDS       T01012                                 

Definition
histone deacetylase 1
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     511911.159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 388 aa AA seqDB search
MAVADIDRPVALIDTSCYSADCSLSALVPQHAMKPYRLLVTMELIKSLGLDRHCRTVVPP
LIGIEQLQTYHAEGYISNLGLHSSQSWLWNTEISKVTFSGDCPPVEGIMEHSLSTVSGSL
MAAILLNSGKADTVIHWGGGMHHAKCGECSGFCYVNDIVIAIIELLKCYKRVLYVDLDMH
HGDGVDEAFCQSNRVFTLSLHKFGESFFPGTGHPRDVGFGNGRHCTMNLALWDGIDDFFY
TTIFEHALSSIVKRYIPDVVVLQCGADSLAGDRLGHFNLSSWGHGKCVEEVKKIGLPMLV
LGGGGYTLRNVAKLWAYETSILCGKKLPLNTVVPVQRMPLSGWLFEGSTQLLVAQDEENK
PLPGVNVQRAFRMVIEQIDKQCPNISFP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgcagatattgatcgtcctgtcgcattaattgacacatcctgctattctgca
gattgtagtctttctgccctggtaccgcaacatgcaatgaagccatatcgtttattagtt
acaatggagcttattaaaagtttgggactagatcgccattgtcgaacagtcgtaccaccc
cttattggaattgaacagttacagacttatcatgcagaaggttacatttcgaaccttggt
cttcatagcagtcaaagttggttatggaatacagaaatttcaaaggtgaccttttcgggg
gattgtcctccagtagaagggataatggaacattcgctttccactgtaagcggttcactt
atggcagccatactcttgaacagtggaaaggctgatactgttattcattggggtggtgga
atgcatcatgcaaaatgtggggaatgctctggattttgttatgtaaacgacatagttatt
gccattattgaactactgaaatgttacaaaagagtcttgtatgtggaccttgatatgcat
catggagatggtgttgatgaggctttttgtcaaagcaatagagtgtttacactatctctt
cataaatttggtgaatcattttttcccggtacggggcacccacgtgacgtaggatttgga
aatggacgtcattgcaccatgaatttggctttgtgggatggtatagatgattttttctac
acgacaatttttgaacatgcactttcctcaattgtgaagcgatacatacctgatgttgtg
gttttacaatgtggtgccgattctttggctggagatcgtcttggacactttaacttatcg
tcatggggacatggaaaatgtgttgaggaagtcaaaaagattggtttgccaatgctggtg
ttgggaggaggaggttataccttaagaaacgttgcaaagctttgggcttacgaaacaagc
attctctgtggtaagaaattgcctttgaatacagttgttcctgtccaaagaatgcccctg
agtggctggttatttgaaggttcgacccagttgttagttgcacaagatgaagaaaacaaa
ccacttcccggtgtcaatgtccagcgagcctttaggatggtcattgagcaaattgataag
caatgtcctaatatcagctttccctaa

DBGET integrated database retrieval system