KEGG   Thermomonospora curvata: Tcur_0246Help
Entry
Tcur_0246         CDS       T01127                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tcu  Thermomonospora curvata
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tcur_0246
Enzymes [BR:tcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Tcur_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
272041..272658
Genome map
AA seq 205 aa AA seqDB search
MTDQGVILYGPPASGKDTITGELAELDERFTLVPKLKAGTGRSTGYRMVTAAELETLRGM
GRLVVETSRYGNVYAVDRHDIEAMTKAGRVPVVHMGNVADLQRLRLSVPLEWTCVLLWAP
REVCARRSRGRGDADRPARLRAWEETRADLAAHRDEAVFHLLIRTDETEPGRAARRIIDA
VAEGPHRALPLSGLDHSSPASRAIT
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatcagggggtgatcctgtacggcccgccggccagcggcaaggacacgatcacg
ggggagctggccgagctggacgagcggttcactctcgtgcccaagttgaaggcgggcacg
ggccgcagcaccggctaccggatggtgacggccgccgagctggagaccctccgcggcatg
gggcgcctggtcgtcgagaccagccggtacggcaacgtctacgccgttgaccggcacgac
atcgaggccatgacgaaggccggcagggtgcctgtcgtccacatgggcaacgtcgccgac
ctgcaacgcttgcggctgtccgtgccgttggagtggacgtgcgtcctgctgtgggcaccg
cgtgaagtctgcgcccggcgctcccgtggccgaggcgacgccgaccggcccgcgcgcttg
cgggcatgggaggagacccgagccgacctggcggcccaccgggatgaggccgtcttccat
ctgctcattcgcaccgatgagaccgaacccggcagggccgcccgccgcatcatcgacgcc
gttgccgaaggccctcaccgggctctgccgctcagcggcttggaccacagctccccggct
tcccgagcgatcacgtga

DBGET integrated database retrieval system