KEGG   Thermomonospora curvata: Tcur_0330Help
Entry
Tcur_0330         CDS       T01127                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00010  Glycolysis / Gluconeogenesis
tcu00020  Citrate cycle (TCA cycle)
tcu00620  Pyruvate metabolism
tcu01100  Metabolic pathways
tcu01110  Biosynthesis of secondary metabolites
tcu01120  Microbial metabolism in diverse environments
tcu01130  Biosynthesis of antibiotics
tcu01200  Carbon metabolism
Module
tcu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcur_0330
   00020 Citrate cycle (TCA cycle)
    Tcur_0330
   00620 Pyruvate metabolism
    Tcur_0330
Enzymes [BR:tcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Tcur_0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 Phage_Gp19
Motif
Other DBs
NCBI-ProteinID: ACY95932
UniProt: D1A1L0
Position
360736..362307
Genome map
AA seq 523 aa AA seqDB search
MPEIKTFKLPDVGEGLTEAEIVRWHVHPGDRVEVNQVIVEIETAKAVVELPCPYEGTVAE
LLVEEGRTVEVGTPIISVSVPAGEAGESAPPPAPDGAAEPGPRQDPETGPSEPARQPVLV
GYGVRPGATRRRPRKRPAAIRHARPAPAPHALAKPPVRKLARDLGVDLSTVTGTGPHGTI
TREDVRQAAERAATSPAPPAVERPGFAEVPQAPVHEGRGPAEMPQEAGGVPGGEAVRGLT
EMPGGVLPGRQGRGPAEMPGGLAEVSAPGEARAVQEGAAGPAVPSAGGREERVPVRGVRK
STAAAMVGSAFTAPQVTEFLQVDVTETMETVRRLRELPEFAELKVTPLLLVAKALLTAVR
RHPMINSSWADGGEAGDEIVVRHYVNLGIATATSRGLLVPNVKDADRLTLPELAAALGRL
VEEARAGRARPADLTGGTITITNIGVFGVDAGTPILTPGEAAILAFGQIRDMPWVHQGEL
AVRKVTTLALTFDHRIVDGELGSAVLRDIGAMLENPLRLLAWS
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagatcaagacgttcaagctgccggacgtgggcgagggcctgaccgaggccgag
atcgtccgctggcatgtgcacccgggcgaccgggtcgaggtcaaccaggtcatcgtggag
atcgagaccgccaaggccgtggtggagctgccctgcccgtatgagggcacggtcgccgag
ctgctggtggaggagggccgcacggtcgaggtgggcacccccatcatctccgtgtcggtc
cccgccggggaggccggggagagcgctccgccgcccgccccggacggtgcggccgaaccc
ggcccccggcaggaccccgagaccgggccgtccgagccggcccggcagccggtgctggtc
gggtacggggtgcggcccggcgccacccgccgccgcccccgcaagcggcccgcggccatc
cgccacgcccggcccgcccccgcgccccatgccctggccaagccgccggtccgcaaactg
gccagggacctgggcgtcgatctgtccaccgtcaccggcaccggcccccacggcacgatc
acccgcgaggacgtgcgccaggccgccgaacgcgccgcgacctccccggcgccgcccgcc
gtcgaacgcccgggtttcgccgaagtcccgcaggcaccggtgcacgaggggcgaggccct
gccgagatgccgcaggaggccggcggcgttcccggcggggaagcggtacgcggtctcact
gagatgcccggaggtgttctgcccggacgccaagggcggggacctgccgaaatgccgggc
gggctcgccgaagtttcggcgcctggagaagcacgggccgtccaggaaggcgcggcggga
cccgccgtcccctcggccggcggccgggaggagcgcgtcccggttcgcggggtgcgcaag
agcaccgccgcggcgatggtcggttcggcgttcaccgcgccgcaggtcaccgagttcctg
caggtggacgtcaccgagacgatggagacggtgcggcggctgcgggagctgccggagttc
gccgagctgaaggtgaccccgctgctgctggtcgccaaggcgctgctgacggcggtgcgg
cggcacccgatgatcaactcctcttgggcggacggcggcgaggccggcgatgagatcgtg
gtcaggcactacgtcaacctcggcatcgccaccgccacctcgcgcggcctgctcgtcccc
aacgtcaaggacgccgaccggctgacgctgcccgagctggcggcggcgctgggccggctg
gtcgaggaggcccgcgccgggcgggcccggccggccgatctgaccggcgggacgatcacc
atcaccaacatcggggtcttcggggtggacgccggcactccgatcctgaccccgggcgag
gccgccatcttggcgttcgggcagatccgggacatgccctgggtgcatcagggcgagctg
gcggtccgcaaggtcaccacgctggcgctgacgttcgatcaccgcatcgtggacggcgag
ctcggctcggccgtgctgcgcgacatcggcgccatgctggagaacccgctgcgcctgctc
gcctggagctga

DBGET integrated database retrieval system