KEGG   Thermomonospora curvata: Tcur_0330Help
Entry
Tcur_0330         CDS       T01127                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tcu  Thermomonospora curvata
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcur_0330
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcur_0330
   00020 Citrate cycle (TCA cycle)
    Tcur_0330
   00620 Pyruvate metabolism
    Tcur_0330
Enzymes [BR:tcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Tcur_0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
360736..362307
Genome map
AA seq 523 aa AA seqDB search
MPEIKTFKLPDVGEGLTEAEIVRWHVHPGDRVEVNQVIVEIETAKAVVELPCPYEGTVAE
LLVEEGRTVEVGTPIISVSVPAGEAGESAPPPAPDGAAEPGPRQDPETGPSEPARQPVLV
GYGVRPGATRRRPRKRPAAIRHARPAPAPHALAKPPVRKLARDLGVDLSTVTGTGPHGTI
TREDVRQAAERAATSPAPPAVERPGFAEVPQAPVHEGRGPAEMPQEAGGVPGGEAVRGLT
EMPGGVLPGRQGRGPAEMPGGLAEVSAPGEARAVQEGAAGPAVPSAGGREERVPVRGVRK
STAAAMVGSAFTAPQVTEFLQVDVTETMETVRRLRELPEFAELKVTPLLLVAKALLTAVR
RHPMINSSWADGGEAGDEIVVRHYVNLGIATATSRGLLVPNVKDADRLTLPELAAALGRL
VEEARAGRARPADLTGGTITITNIGVFGVDAGTPILTPGEAAILAFGQIRDMPWVHQGEL
AVRKVTTLALTFDHRIVDGELGSAVLRDIGAMLENPLRLLAWS
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagatcaagacgttcaagctgccggacgtgggcgagggcctgaccgaggccgag
atcgtccgctggcatgtgcacccgggcgaccgggtcgaggtcaaccaggtcatcgtggag
atcgagaccgccaaggccgtggtggagctgccctgcccgtatgagggcacggtcgccgag
ctgctggtggaggagggccgcacggtcgaggtgggcacccccatcatctccgtgtcggtc
cccgccggggaggccggggagagcgctccgccgcccgccccggacggtgcggccgaaccc
ggcccccggcaggaccccgagaccgggccgtccgagccggcccggcagccggtgctggtc
gggtacggggtgcggcccggcgccacccgccgccgcccccgcaagcggcccgcggccatc
cgccacgcccggcccgcccccgcgccccatgccctggccaagccgccggtccgcaaactg
gccagggacctgggcgtcgatctgtccaccgtcaccggcaccggcccccacggcacgatc
acccgcgaggacgtgcgccaggccgccgaacgcgccgcgacctccccggcgccgcccgcc
gtcgaacgcccgggtttcgccgaagtcccgcaggcaccggtgcacgaggggcgaggccct
gccgagatgccgcaggaggccggcggcgttcccggcggggaagcggtacgcggtctcact
gagatgcccggaggtgttctgcccggacgccaagggcggggacctgccgaaatgccgggc
gggctcgccgaagtttcggcgcctggagaagcacgggccgtccaggaaggcgcggcggga
cccgccgtcccctcggccggcggccgggaggagcgcgtcccggttcgcggggtgcgcaag
agcaccgccgcggcgatggtcggttcggcgttcaccgcgccgcaggtcaccgagttcctg
caggtggacgtcaccgagacgatggagacggtgcggcggctgcgggagctgccggagttc
gccgagctgaaggtgaccccgctgctgctggtcgccaaggcgctgctgacggcggtgcgg
cggcacccgatgatcaactcctcttgggcggacggcggcgaggccggcgatgagatcgtg
gtcaggcactacgtcaacctcggcatcgccaccgccacctcgcgcggcctgctcgtcccc
aacgtcaaggacgccgaccggctgacgctgcccgagctggcggcggcgctgggccggctg
gtcgaggaggcccgcgccgggcgggcccggccggccgatctgaccggcgggacgatcacc
atcaccaacatcggggtcttcggggtggacgccggcactccgatcctgaccccgggcgag
gccgccatcttggcgttcgggcagatccgggacatgccctgggtgcatcagggcgagctg
gcggtccgcaaggtcaccacgctggcgctgacgttcgatcaccgcatcgtggacggcgag
ctcggctcggccgtgctgcgcgacatcggcgccatgctggagaacccgctgcgcctgctc
gcctggagctga

DBGET integrated database retrieval system