KEGG   Thermomonospora curvata: Tcur_0697Help
Entry
Tcur_0697         CDS       T01127                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tcu  Thermomonospora curvata
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcur_0697
   01230 Biosynthesis of amino acids
    Tcur_0697
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcur_0697
  Energy metabolism
   00680 Methane metabolism
    Tcur_0697
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tcur_0697
Enzymes [BR:tcu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Tcur_0697
Exosome [BR:tcu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Tcur_0697
  Exosomal proteins of melanoma cells
   Tcur_0697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
778414..779250
Genome map
AA seq 278 aa AA seqDB search
MATLVLLRHGESVWNAEGLFTGWVDVDLSAKGESEATNGGDLLLDADITPDVVHTSVLKR
AIRTANIALDVADLLWIPVRRSWRLNERHYGALQGKNKAQTREKYGEEQFKIWRRSYDTP
PPPIPDDDPLSQVNDLKYAHLPSELIPRTECLADVVDRLLPYWYDAIVPDLAAGKTVLVV
AHGNSLRALVKHLDDISDTDIAELNIPTGIPLVYELDDDFAPLKRGGEYLDPAAAKAAIE
AVKNQGAAPAGDGAKADKKDDKKADKKDDKKAGRSGKK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgctggttttgctgcggcatggcgaaagcgtgtggaacgcggagggcctgttc
accgggtgggtggacgtggacctgtccgccaagggcgaaagcgaggcgaccaacggcggc
gacctgctgctggacgccgacatcacccccgacgtggtacacacctcggtgctcaagcgg
gcgatccgcaccgccaacatcgccctggacgtcgccgacctgctgtggatcccggtgcgc
cggtcctggcggctcaacgagcggcactacggcgccctgcagggcaagaacaaggcccag
acccgcgagaagtacggcgaggagcagttcaagatctggcggcgctcctatgacaccccg
cccccgccgatccccgacgacgacccgctctcgcaggtcaacgacctcaagtacgcccac
ctgccctcggagctgatcccgcgcaccgagtgcctggccgacgtggtggaccggctgctg
ccctactggtacgacgcgatcgtgccggacctggccgccggcaagaccgtgctggtcgtc
gcgcacggcaactcgctgcgcgccctggtcaagcacctggacgacatctccgacaccgac
atcgccgagctgaacatccccaccggcatcccgctggtctacgagctcgacgacgacttc
gccccgctcaagcgcggcggcgagtacctggacccggccgccgccaaggccgccatcgag
gccgtcaagaaccagggcgccgcccccgccggcgacggcgccaaggccgacaagaaggac
gacaagaaggccgataagaaggacgacaagaaggccggccgcagcggcaagaagtaa

DBGET integrated database retrieval system