KEGG   Thermomonospora curvata: Tcur_0697Help
Entry
Tcur_0697         CDS       T01127                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00010  Glycolysis / Gluconeogenesis
tcu00260  Glycine, serine and threonine metabolism
tcu00680  Methane metabolism
tcu01100  Metabolic pathways
tcu01110  Biosynthesis of secondary metabolites
tcu01120  Microbial metabolism in diverse environments
tcu01130  Biosynthesis of antibiotics
tcu01200  Carbon metabolism
tcu01230  Biosynthesis of amino acids
Module
tcu_M00002  Glycolysis, core module involving three-carbon compounds
tcu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcur_0697
  Energy metabolism
   00680 Methane metabolism
    Tcur_0697
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tcur_0697
Enzymes [BR:tcu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Tcur_0697
Membrane trafficking [BR:tcu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Tcur_0697
Exosome [BR:tcu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Tcur_0697
  Exosomal proteins of melanoma cells
   Tcur_0697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACY96290
UniProt: D1A4Q5
Position
778414..779250
Genome map
AA seq 278 aa AA seqDB search
MATLVLLRHGESVWNAEGLFTGWVDVDLSAKGESEATNGGDLLLDADITPDVVHTSVLKR
AIRTANIALDVADLLWIPVRRSWRLNERHYGALQGKNKAQTREKYGEEQFKIWRRSYDTP
PPPIPDDDPLSQVNDLKYAHLPSELIPRTECLADVVDRLLPYWYDAIVPDLAAGKTVLVV
AHGNSLRALVKHLDDISDTDIAELNIPTGIPLVYELDDDFAPLKRGGEYLDPAAAKAAIE
AVKNQGAAPAGDGAKADKKDDKKADKKDDKKAGRSGKK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgctggttttgctgcggcatggcgaaagcgtgtggaacgcggagggcctgttc
accgggtgggtggacgtggacctgtccgccaagggcgaaagcgaggcgaccaacggcggc
gacctgctgctggacgccgacatcacccccgacgtggtacacacctcggtgctcaagcgg
gcgatccgcaccgccaacatcgccctggacgtcgccgacctgctgtggatcccggtgcgc
cggtcctggcggctcaacgagcggcactacggcgccctgcagggcaagaacaaggcccag
acccgcgagaagtacggcgaggagcagttcaagatctggcggcgctcctatgacaccccg
cccccgccgatccccgacgacgacccgctctcgcaggtcaacgacctcaagtacgcccac
ctgccctcggagctgatcccgcgcaccgagtgcctggccgacgtggtggaccggctgctg
ccctactggtacgacgcgatcgtgccggacctggccgccggcaagaccgtgctggtcgtc
gcgcacggcaactcgctgcgcgccctggtcaagcacctggacgacatctccgacaccgac
atcgccgagctgaacatccccaccggcatcccgctggtctacgagctcgacgacgacttc
gccccgctcaagcgcggcggcgagtacctggacccggccgccgccaaggccgccatcgag
gccgtcaagaaccagggcgccgcccccgccggcgacggcgccaaggccgacaagaaggac
gacaagaaggccgataagaaggacgacaagaaggccggccgcagcggcaagaagtaa

DBGET integrated database retrieval system