KEGG   Thermomonospora curvata: Tcur_0883Help
Entry
Tcur_0883         CDS       T01127                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tcu  Thermomonospora curvata
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcur_0883
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcur_0883
   00620 Pyruvate metabolism
    Tcur_0883
   00640 Propanoate metabolism
    Tcur_0883
  Energy metabolism
   00680 Methane metabolism
    Tcur_0883
Enzymes [BR:tcu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tcur_0883
Lipid biosynthesis proteins [BR:tcu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tcur_0883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
986384..988066
Genome map
AA seq 560 aa AA seqDB search
MSHPAHETFRAARDFLLEHREDYQTAYRDFSWPELEEFNWALDWFDVIAEGNDRTALWIV
EEDGSEERLSFAELSARSARVANWLRERGVRRGDRIVLMLGNQRELWETTLAAIKLGAVL
IPATTLLTPADLRDRVERGGARHVIVSSAQTGKFDDVPGDYTRIAVGEAVPGWHQFADAY
TASADYRPDRPTKATDPLLLYFTSGTTARPKLVEHTHVSYPVGHLSTMYWIGLEPGDVHL
NISSPGWAKHAWSNVFAPWNAEATVFVFNYTRFDADRLLTELDRCQVTSLCAPPTVWRML
IQTDLGRLKNPPRKVVGAGEPLNPEIIEQVRRAWGVTIRDGFGQTETTVQVANTPGQPLK
PGSMGRPVPGYAVELIDMVTGEPAQEGEICLDLSRRPLGLMAGYHGDPERTADVMGDGYY
HTGDIASRDEDGYLTYVGRADDVFKASDYRISPFELESVLLEHEAVAEAAVVPAPDPVRL
AVPKAYVVLAAGWPADEKTAAEIFRHSRENLAPYKRVRRLEFAELPKTVSGKIRRVELRA
RAAGQGPSGREYREEDLRVD
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaccccgcccatgagacgttccgcgccgcccgtgacttcctgctggagcaccgc
gaggactaccagaccgcctaccgcgacttctcctggcccgagctggaggagttcaactgg
gcgctggactggttcgacgtgatcgccgagggcaacgaccgcaccgcgctgtggatcgtg
gaggaggacggctccgaagagcgcctgtcattcgccgagttgtcggcccgctccgcccgg
gtggccaactggctgcgcgaacgcggcgtccgccgcggcgaccgcatcgtgctgatgctc
ggcaaccagcgggagctgtgggagaccaccttggcggccatcaagctcggcgccgtgctg
atccccgccaccaccctgctcacccccgccgacctgcgcgaccgggtggaacgcggcggc
gcccgccacgtgatcgtctcctccgcgcagaccggcaagttcgacgacgtccccggcgac
tacacccgcatcgcggtgggcgaggcggtgcccggctggcaccagttcgccgacgcctac
accgccagtgccgactaccggcccgaccgccccaccaaggccaccgacccgctgctgctg
tacttcacctccggcaccacggcccgccccaagctggtggagcacacccacgtctcctac
ccggtcgggcacctgtcgaccatgtactggatcggcctggaacccggcgacgtccacctg
aacatctcctcgccgggctgggccaagcacgcctggagcaacgtcttcgccccctggaac
gccgaggcgacggtgttcgtgttcaactacacccgcttcgacgccgaccggctgctgacc
gagctggaccgctgccaggtgaccagcctgtgcgccccgccgacggtgtggcgcatgctg
atccagaccgacctgggacggctgaagaacccgccgcgcaaggtggtcggcgccggcgag
ccgctcaaccccgagatcatcgagcaggtgcggcgggcctggggggtgaccatccgggac
gggttcggtcagaccgagaccaccgtgcaggtcgccaacacccccggccagcccctcaag
cccggctcgatggggcggcccgtgcccggatacgccgtcgagctgatcgacatggtcacc
ggcgagcccgcccaggagggcgagatctgcctggacctgtcccgccgcccgctgggcctg
atggccggctaccacggcgaccccgagcgcaccgccgatgtgatgggcgacggctactac
cacaccggcgacatcgcctcccgcgatgaggacggctacctgacctacgtgggccgggcc
gacgatgtgttcaaggcctccgactaccggatctccccgttcgagctggagagcgtcctg
ctggagcacgaggcggtcgccgaggcggcggtggtgcccgcccccgacccggtgcgcctg
gccgtccccaaggcctatgtggtgctggccgccgggtggccggccgacgagaagaccgcc
gccgagatcttccgccactcccgtgagaacctggccccctacaagcgggtgcgccgcctg
gagttcgccgagctgcccaagaccgtctcgggcaagatccgccgcgtcgagctgcgcgcc
cgggcggccgggcaggggccgtccggccgcgaataccgggaggaggacctgcgcgtcgac
tga

DBGET integrated database retrieval system