KEGG   Thermomonospora curvata: Tcur_0911Help
Entry
Tcur_0911         CDS       T01127                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tcu  Thermomonospora curvata
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tcur_0911
   00052 Galactose metabolism
    Tcur_0911
   00500 Starch and sucrose metabolism
    Tcur_0911
   00520 Amino sugar and nucleotide sugar metabolism
    Tcur_0911
Enzymes [BR:tcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tcur_0911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1015680..1016585
Genome map
AA seq 301 aa AA seqDB search
MPDMKPVTKAVVPAAGLGTRFLPATKATPKEMLPIVDKPAIQYVVEEAVAAGLTDVLMIT
GRSKRSIEDHFDRAYELEEALRAKGDEERLASVRQSSELATIHYVRQGDPKGLGHAVYCA
RQHVGDEPFAVLLGDDMIDARDALLTRMIEVRRRYGGSVVALMEVEPDQVSAYGCAAIEP
TDSEDTVRITDLVEKPPADQAPSRWIIIGRYVCDPAVFDVLEKTPPGRGGEIQLTDALLT
LAHMPADQGGGVHGVLFRGRRYDTGNKLEYLRTVVQFASEREDLAPEFMPWLREFVNKHG
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacatgaaacctgtgacgaaggccgtcgtccctgcggccggcctcggtacccga
ttcttgcccgccaccaaggccacccccaaggagatgctgcccatcgtcgacaaaccggcg
atccagtacgtggtcgaagaagcggtggccgcggggttgaccgatgtgctgatgatcaca
gggcgcagcaaacgttctattgaagaccatttcgatagggcttacgaacttgaggaggcg
ctgcgcgccaagggcgacgaggagcggctggcctccgtccggcagtccagcgagctggcc
accatccactatgtgcggcagggcgaccccaaagggctcggccacgcggtctactgcgca
cgccagcacgtgggagacgagccgttcgcggtgctgctcggcgacgacatgatcgacgcg
cgggacgccctgctgacccgcatgatcgaagtccgccggcggtacggcggcagcgtggtg
gcgttgatggaggtcgagcccgaccaggtctccgcctacgggtgcgcggccatcgagccg
accgattcggaagacaccgtgcgcatcaccgacctggtcgaaaaaccccccgccgaccag
gcccccagccggtggatcatcatcggccgctacgtctgcgacccggccgtcttcgacgtg
ctggagaagaccccgcccggccgcggcggcgagatccagctgaccgacgccctgctgacc
ctcgcccacatgcccgccgaccagggcggcggggtgcacggcgtactgttccggggacgg
cgctacgacaccggcaacaagctggagtacctgcgcaccgtggtgcagttcgcctccgaa
cgggaagacctggcaccggagttcatgccctggcttcgggagttcgtcaacaagcacggc
tcgtga

DBGET integrated database retrieval system