KEGG   Thermomonospora curvata: Tcur_0925Help
Entry
Tcur_0925         CDS       T01127                                 

Definition
protein-L-isoaspartate(D-aspartate)O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tcu  Thermomonospora curvata
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1027249..1028472
Genome map
AA seq 407 aa AA seqDB search
MSAKPASSEVLRNAMVDRLAADHAAKGLTLHPEVEAAMRAVPRELYVPGVPLEEAYENTA
VITKRLPSGENVSSVSAPFLIAEMLGQAMGALGGLKGRHVLEIGSGGYNASLLAELVGTA
GSVTTVDIDPEVADRVAACLKTAGYHDVTVVCADAEHPIEPGRGYDLIIVTAGAWDIPPA
WREQLTEGGVLVVPLRTFGTTRSWALRRVGDRLVSHSHRQCGFVPVQGAGAHQIRCIDLA
EGVHLRLDEGEQIDADAVKGVLEQPRREAWAGLSLPPATRLHDLSLWHATRLREHAVVLT
AQEEAIASGIVAPSWQHGTSATVHNGTLAYRTLRWTDRRFDLGAYAHGPDAQAAAERMVE
NMRAWVEAGCPTPALEVLPACTPDGDLPDGTVLDKRHSRLVVSFIPG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgccaagcccgcgagcagcgaggtcctgcggaacgcgatggtcgaccggctggcc
gccgatcacgcggcgaaagggctcacgctgcacccggaggtggaggcggcgatgcgggcc
gttccccgcgagctgtatgtgccgggcgttccgctggaggaggcctacgagaacaccgcg
gtcatcaccaagcggctccccagcggggagaacgtcagctcggtgtcggcgccgttcctg
atcgcggagatgctgggccaggcgatgggcgcgctcggcggcctgaagggccggcatgtg
ctggagatcggcagcggcggctataacgcgtccctgctggccgaactcgtcggaacggcc
ggatcggtcacgaccgtcgacatcgatcccgaggtggccgaccgggtcgccgcctgcctg
aaaacggcgggctaccacgacgtcaccgtggtctgcgcggacgccgagcacccgatcgaa
ccgggccgcggctacgacctgatcatcgtcacggccggggcctgggacatcccacccgcc
tggcgtgagcagctcaccgagggcggcgtgctggtcgtgccgttgcggacgttcgggacg
accaggtcatgggcgctgcggcgggtgggcgaccggctggtcagccacagccatcgccag
tgcgggttcgttcccgtgcagggcgccggcgcccaccagatccgctgcatcgacctcgcc
gagggcgttcacctgcgcctcgacgaaggcgagcagatcgacgccgacgccgtcaaaggc
gtcctggagcagccgaggcgggaggcgtgggccgggctgagcctgccgcccgccacccgg
ttgcacgacctgagcctgtggcacgcgacccgcctgcgcgagcacgccgtggtcttgacc
gcgcaggaagaggccatcgcttccgggatcgtcgccccgtcctggcagcacggcacctcc
gccaccgtgcacaacggcacgctcgcctaccggactcttcgctggaccgaccggcgtttc
gacctcggcgcctacgcgcatgggcccgacgcacaggcggccgccgagcggatggtcgag
aacatgcgcgcctgggtggaggccggctgtcccaccccggccctggaggtcttgcccgcc
tgcaccccagacggcgatctgccggacgggaccgtcctggacaagcggcacagccgcctc
gtcgtgtccttcatccccggttga

DBGET integrated database retrieval system