KEGG   Thermomonospora curvata: Tcur_1214Help
Entry
Tcur_1214         CDS       T01127                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tcu  Thermomonospora curvata
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tcu00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1373328..1374845)
Genome map
AA seq 505 aa AA seqDB search
MADFVGAVDQGTTSTRFMIFDHGGNEVARHQLEHEQILPRAGWVEHNPVEIWERTRTVIE
TALNKADLTARDLAALGITNQRETAVVWNRRTGRPYYNAIVWQDTRTDRIAAALERDGRG
EVIRRKAGLPPATYFSAGKVQWILENVPGVREAAEAGEALFGTIDTWLLWNLTGGVDGGV
HVTDVTNASRTMLMDLETLEWDEELLSFFGIPRAMLPQIRPSSDPAGYGVTRADGPLGGE
VPLSGALGDQQAATVGQVCFEPGQAKNTYGTGNFLLLNTGTEPVRSRHGLLTTVCYRFGD
AKPVYALEGSIAVTGSAVQWLRDQLRIISTAAQSEILARQVDDNGGVYFVPAFSGLFAPY
WRSDARGVIVGLSRYNNAAHIARATLESICYQTRDVVEAMQQDSGVVLDVLRVDGGVTAN
DLCMQIQADVLGVPVSRPVVAETTALGAAYAAGMATGFWKSTEELVRNWNEDRRWLPQWD
DEQRAAGYAGWKKAVERTLDWVDVG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcgtgggagcggtcgaccagggcaccaccagcacccggttcatgatcttc
gaccatggcggcaacgaggtggcccggcaccagctggagcacgagcagatcctgccgcgg
gccggctgggtggagcacaaccccgtggagatctgggagcgcacccggacggtcatcgag
accgcgctgaacaaggccgacctgaccgcccgggacctggccgcgctcggcatcaccaac
cagcgcgagaccgccgtggtgtggaaccggcgcaccggccgcccctactacaacgcgatc
gtctggcaggacacccgcaccgaccggatcgccgcggcgctggagcgcgacgggcggggc
gaggtgatccgccgcaaggcgggcctgcccccggcgacgtacttctccgccggcaaggtg
cagtggatcttggagaacgtccccggggtgcgcgaggcggccgaggccggcgaggcattg
ttcggcaccatcgacacctggctgctgtggaacctgaccggcggggtcgacggcggcgtc
cacgtcaccgacgtcaccaacgccagccgcaccatgctgatggacctggagacgctggag
tgggacgaggagctgctgtcgttcttcggcatcccgcgcgcgatgctgccgcagatccgg
ccgtccagtgacccggccggctacggggtgacccgggcggacggcccgctgggcggggag
gtgccgctgtcgggggcgctgggcgaccagcaggccgccacggtcgggcaggtgtgcttc
gaacccggccaggccaagaacacctacggcaccggcaacttcctgctgctgaacaccggc
accgagccggtgcgctcccgccacggcctgctcaccaccgtgtgctaccggttcggcgac
gccaagccggtgtacgcgctggaggggtccatcgcggtgaccgggtcggcggtgcagtgg
ctgcgcgaccagcttcggatcatctccaccgcggcgcagagcgagatcctggcccgtcag
gtcgacgacaacggcggcgtgtacttcgtgccggccttctccggcctgttcgccccgtac
tggcggtcggacgcccgcggcgtcatcgtcggcctgtcgcgctacaacaacgccgcccac
atcgcccgcgccacgctggagtcgatctgctaccagacccgggacgtggtggaggcgatg
cagcaggactccggcgtggtgctggacgtgctgcgggtcgacggcggcgtcaccgccaac
gacctgtgcatgcagatccaggccgacgtgctgggcgtgccggtctcccgcccggtggtg
gccgagaccaccgcgctgggcgccgcctacgccgccgggatggccaccggtttttggaag
tccaccgaggagctggtccgcaactggaacgaggaccgccgctggctgccgcagtgggac
gacgagcagcgcgccgcgggctatgcgggctggaagaaggccgtggagcggacgctggac
tgggtcgacgtcggctga

DBGET integrated database retrieval system