KEGG   Thermomonospora curvata: Tcur_1271Help
Entry
Tcur_1271         CDS       T01127                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
tcu  Thermomonospora curvata
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tcur_1271
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tcur_1271
Enzymes [BR:tcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Tcur_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1446898..1449276
Genome map
AA seq 792 aa AA seqDB search
MTDTAVPVHPTAPTDAEVRLLDAHWRAANYLSAGQIYLLDNPLLREPLQPGHIKPRLLGH
WGTTPGLNFCYTHLNRVIRTRDQNMIYIMGPGHGGPAAVANAWLEGTYSEVYPEVSWDET
GMARLFRQFSFPGGVPSHVAPETPGSIHEGGELGYALVHAFGAAFDNPDLVVACIVGDGE
AETGPLAAAWHSNKFLDPVRDGAVLPILHLNGYKIANPTVPARIPERELLALFEGYGYRP
YVVAGDDPAVMHRKMAETLDRVMDEITAIQRNAREGGNKGRPRWPMIILRTPKGWTGPKE
VDGVPVEGTWRSHQVPLPGVRENPEHLALLERWLRSYRPWELFDGTGRPVPQVLAQTPRG
ERRMSANPHANGGLLLRPLRLPDFRDYAVPVDRPATTFAEPTRVLGALLRDVIAANPDNF
RIMGPDETASNRLNAVFEVTDRTWQAERLPTDDHLAPSGRVMEVLSEHLCQGWLEGYLLT
GRHGLFNCYEAFIHIVDSMFNQHAKWLKVTRALPWRRPIASLNYLLSSHVWRQDHNGFTH
QDPGFLDVVMNKKPEIIRVYLPPDANTLLAVTDGCLRSRDCINVIVAGKQPVLNLLPMDD
AVVHCARGIGIWEWAGTDAGAEPDVVLACAGDVPTLETLAAADLLRRHLPQLRVRVVNVV
DLMRLQPPTEHPHGLTDPEFDALFTTDKPIIFAFHGYPYLIHRLTYRRHGHGNLHVRGYK
EEGTTTTPFDMVMMNDLDRFHLVMDVIDRVPGLGVRAGHVRQLMADERIRHRAYTREHGE
DPADITEWVWPH
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaccgccgtacccgttcatcccaccgcgccgaccgatgcggaggtgcgcctg
ctggacgctcactggcgggccgccaactacctgtcggccgggcagatctacctgctggac
aacccgctgctgcgggagccgctgcagcccggccacatcaagccgcgcctgctgggccac
tggggcaccacgcccggcctgaacttctgctacacccacctcaaccgggtcatcaggacc
cgcgaccagaacatgatctacatcatggggccgggccacggcgggccggcggcggtggcc
aacgcctggctggagggcacctacagcgaggtctacccggaggtctcctgggacgagacc
ggcatggcccggctgtttcggcagttctccttccccggcggcgtgcccagccacgtggcc
cccgagacgcccggctccatccacgagggcggcgagctgggctatgcgctggtgcacgcc
ttcggcgccgccttcgacaaccccgacctggtggtggcctgcatcgtgggcgacggcgag
gccgagaccgggccgctggcggccgcctggcactccaacaagttcctcgacccggtgcgc
gacggcgcggtgctgccgatcctgcacctgaacggctacaagatcgccaaccccacggtg
ccggcccgcatccccgaacgggaactgctggcactgttcgaaggctacggctaccgcccc
tacgtggtcgccggagacgacccggccgtcatgcaccggaagatggccgagaccctcgac
cgggtcatggatgagatcaccgccatccagcgcaacgcccgcgagggcgggaacaaaggc
cgcccccgctggccgatgatcatcctgcgcacccccaagggctggaccggccccaaggag
gtcgacggcgtgccggtggagggcacctggcgctcccaccaggtgccgctgccgggggtg
cgcgagaaccccgagcatctggccctgctggagcggtggctgcgctcttaccggccctgg
gagctgttcgacggcaccggccgcccggtgccgcaggtgctggcacagaccccgcggggg
gagcggcggatgagcgccaacccgcacgccaacggcgggctgctgctgcgcccgctgcgc
ctgcccgacttccgcgactacgccgtcccggtggaccggccggccaccaccttcgccgag
ccgacccgggtgctgggcgcgctgctgcgggacgtgatcgccgccaaccccgacaacttc
cgcatcatgggcccggacgagaccgcctccaaccggctgaacgcggtcttcgaggtcacc
gaccggacctggcaggccgagcggctgcccaccgacgaccacctggccccctccggccgg
gtgatggaagtgctcagcgagcacctgtgccagggctggctggagggctacctgctgacc
ggccggcacggcctgttcaactgctatgaggcgttcatccacatcgtcgactcgatgttc
aaccagcacgccaagtggctgaaggtcacccgcgccctgccgtggcggcggcccatcgcc
tcgctgaactacctgctgtcctcgcacgtgtggcggcaggaccacaacggcttcacccac
caggaccccggcttcctggacgtggtgatgaacaagaaacccgagatcatccgggtctac
ctgccgccggacgccaacaccctgctggcggtgaccgacggctgcctgcgctcccgcgac
tgcatcaacgtgatcgtggcgggcaagcagccggtgctgaacctgctgccgatggacgac
gccgtcgtccactgcgcccgcggcatcggcatctgggagtgggccggcaccgacgccggc
gccgaacccgacgtggtgctggcctgcgccggggacgtgccgaccctggagacgctggcc
gccgccgacctgctgcggcgccatctgccacagctgcgggtgcgggtggtcaacgtggtg
gacctgatgcggctgcagccgcccaccgagcacccccacggcctgaccgacccggagttc
gacgcgctgttcaccaccgacaagccgatcatcttcgccttccacggctacccgtacctg
atccaccggctcacctaccgccggcacgggcacggcaacctgcatgtgcgcggctacaag
gaggaaggcaccaccaccacgcccttcgacatggtcatgatgaacgacctggaccgcttc
cacctggtcatggacgtcatcgaccgggtgccggggctgggcgtgcgggccgggcacgtc
cgccagctcatggcggacgagcggatccgccaccgcgcctacacccgcgagcacggcgag
gaccccgccgacatcaccgaatgggtctggccgcactga

DBGET integrated database retrieval system