KEGG   Thermomonospora curvata: Tcur_1309Help
Entry
Tcur_1309         CDS       T01127                                 

Definition
cobaltochelatase subunit (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
tcu  Thermomonospora curvata
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tcu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1489586..1491559
Genome map
AA seq 657 aa AA seqDB search
MSGAARYPFSAVVGMDDLKLALLINAVSPGVGGVLVRGEKGTAKSTIVRALAALLPPVRV
VAGCRFSCDPADPDPACPDGPHRPDGAAAATRPARLVELPVGASEDRVTGSLDIERALTE
GVKAFEPGLLAAAHRGVLYVDEVNLLHDHLVDLLLDAAAMGRCHIEREGVSVQHAARFLL
VGTMNPEEGELRPQLLDRFGLTVEVAATRDPDERAEVVRRRLHFEADPEGFAARWAEAEA
ELAERIAAARRRLPGVRLGEAALRQITAVCAAFEVDGLRADLVTARAAIALAAWHGRDAV
TTEDVRQAARLALPHRRRRDPFDAPGLDRDRLDQVLGEHTDPEPPGGPGGPGGGRPAEES
TGRPPASPEGSPAAPAAAPSPGDAPAAEGKPADPAPTGALYRPRLFTVPGVGTGAPGRRS
KARTPHGRVSGARPGRRDLHLMATLRAAAPHQHARGRTGPGLVIAPEDLRAALRDGREGN
LVLFVVDASGSMAARRRMGAVKGAVLSLLLDAYQRRDKVGLITFRGRGAELALPPTSSVE
AGARRLERLPTGGRTPLAAGLLRAAEVLRVERLRDPARRPLLVIVTDGRATTGPDPAQAA
ALLRGVAAVVVDCESGPVRLGLARRLAALLEARAVRLEELAADGLARIVRDARRDAA
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgccgcgcgctaccccttctcggccgtggtcggcatggacgacctcaagctg
gccctgctgatcaacgcggtctcccccggcgtgggcggggtgctggtccgcggcgagaag
ggcaccgccaaatcgacgatcgtgcgggcgctggccgcgctgctgcccccggtccgcgtg
gtggccggctgccgtttctcctgcgacccggccgaccccgacccggcctgccccgacggc
ccgcaccggccggacggcgccgcggccgccacccgcccggcccgcctggtcgagctgccc
gtgggcgcctccgaggaccgggtgaccggctcgctggacatcgagcgggcgctcaccgag
ggcgtcaaggcgttcgaacccggcctgctggccgccgcgcaccggggcgtgctgtacgtc
gatgaggtcaacctgctccacgaccacctggtcgacctgctgctggacgccgccgccatg
ggccgctgccacatcgagcgcgagggcgtgtcggtgcagcacgccgcccgtttcctgctg
gtgggcaccatgaaccccgaagaaggggagctgcgcccccagctgctggaccgcttcggg
ctgaccgtcgaggtcgccgccacccgcgacccggacgaacgcgccgaggtggtgcggcgg
cggctgcacttcgaagccgaccccgaaggcttcgccgcccggtgggccgaggccgaggcc
gagctggccgagcggatcgccgccgcccggcggcgcctgcccggcgtccgcctgggcgag
gccgcgctgcgccagatcaccgcggtctgcgccgccttcgaggtggacgggctgcgcgcc
gacctggtgaccgcccgcgccgccatcgcgctggccgcctggcacggccgggacgcggtg
accaccgaggacgtccggcaggcggcccggctggcgctgccgcaccgccgccgccgcgac
ccgttcgacgcccccggcctcgaccgggaccggctcgaccaggtgctgggcgagcacacc
gatcccgaacccccgggcggcccgggcggcccaggcggcgggcggcccgccgaagaaagc
accggccggccgccggcctcgccggagggttctcctgcggcgccggccgcggccccttcg
ccgggggacgccccggccgccgaggggaagccggccgacccggcgcccaccggcgccctc
taccggccgcgcctgttcaccgtccccggcgtcggcaccggggcgcccggccgccgctcc
aaggcccgcaccccccacgggcgggtctcgggcgcccgccccggccgccgcgacctgcac
ctgatggccaccctccgcgccgcggccccccaccagcacgcccgcggacgcaccggcccc
ggcctggtcatcgcccccgaggacctccgcgcggcgctgcgggacggccgcgagggcaac
ctggtgctgttcgtggtggacgccagcggctcgatggccgcccgcaggcggatgggggcg
gtcaaaggcgcggtgctgagcctgctgctggacgcctaccagcgccgcgacaaggtcggc
ctgatcaccttccggggccggggggccgagctggcgctgccccccacctcctcggtggag
gccggcgcccgccggctggaacggctgccgaccgggggccgcaccccgctggccgccggc
ctgctgcgcgccgccgaggtattgcgcgtcgaacggctgcgcgacccggcccgccgtccc
ctgctggtgatcgtcaccgacggccgcgccaccaccggccccgacccggcacaggccgcc
gccctgctgcgcggcgtggccgcggtggtggtggactgcgagtccggccccgtccggctc
ggcctggcccgccgcctggcggcgctgctggaggcccgggcggtgcgcctggaggaactg
gccgccgacggcctggcccgcatcgtccgcgacgcccggcgggacgcggcctga

DBGET integrated database retrieval system