KEGG   Thermomonospora curvata: Tcur_1309Help
Entry
Tcur_1309         CDS       T01127                                 

Definition
(GenBank) cobaltochelatase subunit
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00860  Porphyrin and chlorophyll metabolism
tcu01100  Metabolic pathways
tcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tcur_1309
Enzymes [BR:tcu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Tcur_1309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase AAA_5 VWA MCM AAA_16 Sigma54_activat AAA_29
Motif
Other DBs
NCBI-ProteinID: ACY96892
UniProt: D1A9V6
Position
1489586..1491559
Genome map
AA seq 657 aa AA seqDB search
MSGAARYPFSAVVGMDDLKLALLINAVSPGVGGVLVRGEKGTAKSTIVRALAALLPPVRV
VAGCRFSCDPADPDPACPDGPHRPDGAAAATRPARLVELPVGASEDRVTGSLDIERALTE
GVKAFEPGLLAAAHRGVLYVDEVNLLHDHLVDLLLDAAAMGRCHIEREGVSVQHAARFLL
VGTMNPEEGELRPQLLDRFGLTVEVAATRDPDERAEVVRRRLHFEADPEGFAARWAEAEA
ELAERIAAARRRLPGVRLGEAALRQITAVCAAFEVDGLRADLVTARAAIALAAWHGRDAV
TTEDVRQAARLALPHRRRRDPFDAPGLDRDRLDQVLGEHTDPEPPGGPGGPGGGRPAEES
TGRPPASPEGSPAAPAAAPSPGDAPAAEGKPADPAPTGALYRPRLFTVPGVGTGAPGRRS
KARTPHGRVSGARPGRRDLHLMATLRAAAPHQHARGRTGPGLVIAPEDLRAALRDGREGN
LVLFVVDASGSMAARRRMGAVKGAVLSLLLDAYQRRDKVGLITFRGRGAELALPPTSSVE
AGARRLERLPTGGRTPLAAGLLRAAEVLRVERLRDPARRPLLVIVTDGRATTGPDPAQAA
ALLRGVAAVVVDCESGPVRLGLARRLAALLEARAVRLEELAADGLARIVRDARRDAA
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgccgcgcgctaccccttctcggccgtggtcggcatggacgacctcaagctg
gccctgctgatcaacgcggtctcccccggcgtgggcggggtgctggtccgcggcgagaag
ggcaccgccaaatcgacgatcgtgcgggcgctggccgcgctgctgcccccggtccgcgtg
gtggccggctgccgtttctcctgcgacccggccgaccccgacccggcctgccccgacggc
ccgcaccggccggacggcgccgcggccgccacccgcccggcccgcctggtcgagctgccc
gtgggcgcctccgaggaccgggtgaccggctcgctggacatcgagcgggcgctcaccgag
ggcgtcaaggcgttcgaacccggcctgctggccgccgcgcaccggggcgtgctgtacgtc
gatgaggtcaacctgctccacgaccacctggtcgacctgctgctggacgccgccgccatg
ggccgctgccacatcgagcgcgagggcgtgtcggtgcagcacgccgcccgtttcctgctg
gtgggcaccatgaaccccgaagaaggggagctgcgcccccagctgctggaccgcttcggg
ctgaccgtcgaggtcgccgccacccgcgacccggacgaacgcgccgaggtggtgcggcgg
cggctgcacttcgaagccgaccccgaaggcttcgccgcccggtgggccgaggccgaggcc
gagctggccgagcggatcgccgccgcccggcggcgcctgcccggcgtccgcctgggcgag
gccgcgctgcgccagatcaccgcggtctgcgccgccttcgaggtggacgggctgcgcgcc
gacctggtgaccgcccgcgccgccatcgcgctggccgcctggcacggccgggacgcggtg
accaccgaggacgtccggcaggcggcccggctggcgctgccgcaccgccgccgccgcgac
ccgttcgacgcccccggcctcgaccgggaccggctcgaccaggtgctgggcgagcacacc
gatcccgaacccccgggcggcccgggcggcccaggcggcgggcggcccgccgaagaaagc
accggccggccgccggcctcgccggagggttctcctgcggcgccggccgcggccccttcg
ccgggggacgccccggccgccgaggggaagccggccgacccggcgcccaccggcgccctc
taccggccgcgcctgttcaccgtccccggcgtcggcaccggggcgcccggccgccgctcc
aaggcccgcaccccccacgggcgggtctcgggcgcccgccccggccgccgcgacctgcac
ctgatggccaccctccgcgccgcggccccccaccagcacgcccgcggacgcaccggcccc
ggcctggtcatcgcccccgaggacctccgcgcggcgctgcgggacggccgcgagggcaac
ctggtgctgttcgtggtggacgccagcggctcgatggccgcccgcaggcggatgggggcg
gtcaaaggcgcggtgctgagcctgctgctggacgcctaccagcgccgcgacaaggtcggc
ctgatcaccttccggggccggggggccgagctggcgctgccccccacctcctcggtggag
gccggcgcccgccggctggaacggctgccgaccgggggccgcaccccgctggccgccggc
ctgctgcgcgccgccgaggtattgcgcgtcgaacggctgcgcgacccggcccgccgtccc
ctgctggtgatcgtcaccgacggccgcgccaccaccggccccgacccggcacaggccgcc
gccctgctgcgcggcgtggccgcggtggtggtggactgcgagtccggccccgtccggctc
ggcctggcccgccgcctggcggcgctgctggaggcccgggcggtgcgcctggaggaactg
gccgccgacggcctggcccgcatcgtccgcgacgcccggcgggacgcggcctga

DBGET integrated database retrieval system