KEGG   Thermomonospora curvata: Tcur_1347Help
Entry
Tcur_1347         CDS       T01127                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tcu  Thermomonospora curvata
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tcur_1347
Enzymes [BR:tcu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Tcur_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1532945..1535098
Genome map
AA seq 717 aa AA seqDB search
MADEQLVRLARGYRVGTGYTDWRGRTVEVPRDTIVAVLAALGVDAATPAAVRAELARLEE
RGRTRPLPPVVVCWADERSGAGRIAVPARPAPGAEALLIRADGGTSRLPPAGRRRTSGPD
PVDHDLYLLPEGTPPGLHRLRLRRNGREEETALLVAPARLKEAPRAWGLMAQLYSVRSRA
SWGMGDLRDLADLAAWGAEALGADFVLVNPLHAAEPVPPVNPSPYSPMSRRFAAPLYLRI
EDLPEYAALGPADRERVEALAAPLRRKARTLREIDRDRIWRAKLAALEICHRQRRGTRQQ
DDYERFKKREGEALTAFATWCALAEEHGPDWRCWPAALQDPAAPAVAAERRRLAGRIDFH
TWLQWRLDEQLAEAQSAARRAGMRIGIVHDLAVGVAHGGADTWIHRAVFAAGMSVGAPPD
EFNQRGQDWGQPPWHPRRLAEAEYRPYRGMLAAALRHGGGLRLDHAMQISRLWWVPEGRS
PAEGTYVGYDREAMLACLVLEAARTGAVVIGEDLGTVEPEVRADLAARGVLGTDLLWFER
DEHGRPRPPGAWREPALATVGTHDMPPITGFLHGDHVVLRARLGLLTRPAPEEAADHRAA
LAAWLALLADQGLLTTRPEEILRALAGGSTAHDEEVVTALHAFLARTPARLLGIALTDAV
GERRIQNQPGTGDEHPNWRIPLADAQGRPVLLDDLPTARIRALLAPVLQRSPDSASR
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
gtggcggacgagcaactggtcagactggcccgggggtaccgcgtcggcaccggctacacc
gactggcgcgggcgcaccgtggaggtgccccgcgacaccatcgtcgcggtcctggccgcg
ctcggcgtggacgccgccacccctgcggcggtgcgggcggaactggcccggctggaggag
cgcggccgcacccgtccgctgcctcccgtggtggtctgctgggcggacgaacgctccggc
gcggggcggatcgccgtcccggcccgccccgcacccggcgccgaggccctgctgatccgg
gccgacggcgggacgagccgcctgccgcccgccgggcgccgccgcacgtccgggcccgac
cccgtggaccatgacctgtaccttctccccgaagggacgccgccgggcctgcaccggctg
cgcctgcggcggaacggccgggaagaggagaccgccctgctggtggccccggccaggctg
aaagaggcgccgcgcgcctgggggctgatggcccagctgtattcggtgcgttcccgcgct
tcctgggggatgggcgacctgcgggacctggcggatttggcggcctggggagccgaggcg
ctgggcgcggacttcgtgctggtcaacccgctgcacgcggccgaacccgtccctccggtc
aacccctcgccctactcgccgatgagccgccgcttcgccgcccccctctacctgcgcatc
gaggacctgcccgagtacgcggccctggggccggccgaccgcgaacgcgtcgaagccctg
gccgccccgctgcgccgcaaggcgcgcaccctgcgggagatcgaccgggaccgcatctgg
cgggccaagctggccgccttggagatctgccaccggcagcggcgcggcacccggcagcag
gacgactacgagcgtttcaaaaaacgggagggcgaggcgctcaccgcgttcgccacctgg
tgcgccctggccgaagaacacggcccggactggcggtgctggcccgccgcgctgcaggac
ccggccgcccccgccgtggcggccgagcgcaggcgcctggccgggcgcatcgacttccac
acctggctgcagtggcggctggacgagcagctggccgaggcccagtcggccgcccgccgc
gccgggatgcggatcggcatcgtccacgacctggccgtgggagtggcccacggcggcgcc
gacacctggatccaccgcgcggtgttcgccgccggcatgagcgtgggcgccccgcccgat
gagttcaaccagcgcggccaggactggggccagccgccctggcacccccgccgcctggcc
gaggccgagtaccggccctaccgcggcatgctcgccgccgcgctgcgccacggcggcggc
ctgcggctggaccacgccatgcagatctcccgcctgtggtgggtgcccgagggccgctcc
ccggccgagggcacctatgtgggctatgaccgcgaggcgatgctggcgtgcctggtgctg
gaggccgcccgcaccggcgcggtggtgatcggcgaggacctgggcaccgtcgagccggag
gtgcgcgcggacctggccgcccgcggcgtgctcggcaccgacctgctgtggttcgaacgc
gacgagcacggccgtccccgcccgcccggcgcctggcgggagccggccctggccacggtc
ggcacccacgacatgcccccgatcaccggcttcctgcacggcgaccacgtggtgctgcgc
gcccggctgggcctgctcacccgccccgcccccgaggaggccgccgaccaccgcgccgcg
ctggccgcctggctggccctgctggccgaccagggcctgctgaccacccgccccgaggag
atcctgcgcgccctggccgggggctcgaccgcccacgacgaggaggtggtcaccgccctg
cacgccttcctggcccgcacccccgcccgcctgctcggcatcgccctgaccgacgccgtg
ggcgaacgccgcattcaaaaccagcccggcaccggcgacgagcaccccaactggcgcatc
cccctggccgacgcccagggccgccccgtcctcctggacgacctgcccaccgcccgcatc
cgcgccctgctcgcccccgttctgcaacgttccccggactcggcgtctcgttag

DBGET integrated database retrieval system