KEGG   Thermomonospora curvata: Tcur_1671Help
Entry
Tcur_1671         CDS       T01127                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00260  Glycine, serine and threonine metabolism
tcu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tcu01100  Metabolic pathways
tcu01110  Biosynthesis of secondary metabolites
tcu01130  Biosynthesis of antibiotics
tcu01230  Biosynthesis of amino acids
Module
tcu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tcur_1671
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tcur_1671
Enzymes [BR:tcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tcur_1671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ACY97246
UniProt: D1ABL0
Position
complement(1958660..1960021)
Genome map
AA seq 453 aa AA seqDB search
MADETGSTKILLDESRIPRRWYNVVADLPAPPPPPLHPGTREPVGPEDLAPLFPIDLIEQ
EVSLERYLDIPEEVREVYRLWRPTPLYRARRLEKALGTPARIYYKYEGVSPSGSHKPNTA
VPQAFYNAKHGIRRLTTETGAGQWGSSLAFACSMYGLECEVWMVRASYDQKPYRRLMMET
YGARVHASPSPLTTAGAKILAEDADSPGSLGIAISEAVEVAAGADDTRYALGSVLNHVLL
HQTVIGEEALEQLASVGETPDVIVGCTGGGSNFAGLIFPFLREKLAGRIDPVLRAVEPAA
CPSLTRGRYEYDFGDTAGLTPLMKMHTLGHDFVPDPIHAGGLRYHGMAPLLSHIYELGLF
EAVAKRQRECFEAGILFARAEGIVPAPEGTHALAGAIEEARRCAETGEEKVILTALSGHG
HFDMSSYERYLSGEMEDFDLPQERIEQSLARLP
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacgaaacggggtcgaccaagatcctgctggacgagtcgcgcatcccgcgccgg
tggtacaacgtggtcgccgacctgccggcgccgccgcccccgccgctgcacccggggacg
cgggagccggtggggccggaggacctggcgccgctgttccccatcgacctcatcgagcag
gaggtcagcctggagcgctacctggacatccccgaggaggtccgggaggtctaccggctg
tggcggccgaccccgctgtaccgggcccggcggctggagaaggcgctgggcaccccggcg
cggatctactacaagtacgagggcgtctccccgtccggctcgcacaagcccaacaccgcc
gtcccgcaggcgttctacaacgccaagcacggcatccggcggctgaccaccgagaccggg
gccgggcagtggggcagctcgctggcgttcgcctgctcgatgtacgggctggagtgcgag
gtgtggatggtccgcgcctcctatgaccaaaagccctaccggcggctgatgatggagacc
tacggcgcccgggtgcacgccagtccctcgccgctgaccacggcgggcgccaagatcctg
gccgaggacgccgactcccccggctcgctgggcatcgccatcagcgaggccgtggaggtc
gccgccggcgccgacgacacccgctacgccctgggcagcgtgctcaaccacgtgctgctg
caccagacggtgatcggcgaggaggcgctggagcagctggcctcggtcggcgagaccccg
gatgtgatcgtcggctgcaccggcggcggctccaacttcgccgggctgatcttcccgttc
ctgcgcgagaagctggccgggcggatcgacccggtgctgcgcgcggtggagccggcggcc
tgcccgtcgctgacccggggccgctatgagtacgacttcggcgacaccgccgggctcacc
ccgctgatgaagatgcacaccctcgggcacgacttcgtccccgaccccatccacgccggc
gggctgcgctaccacggcatggcgccgctgctgtcgcacatctacgagctgggcctgttc
gaggccgtggccaagcggcagcgcgagtgcttcgaggcgggcatcctgttcgcccgcgca
gaaggcatcgtcccggcccccgagggcacccacgccctggccggggccatcgaggaggcc
cgccgctgcgccgagaccggcgaggagaaggtcatcttgaccgccctgtccggccacggc
cacttcgacatgagctcgtacgagcgctacctgtccggcgagatggaggacttcgacctg
ccgcaggagcgcatcgagcagtccctggcccgcctgccgtga

DBGET integrated database retrieval system