KEGG   Thermomonospora curvata: Tcur_1671Help
Entry
Tcur_1671         CDS       T01127                                 

Definition
pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tcu  Thermomonospora curvata
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tcur_1671
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tcur_1671
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tcur_1671
Enzymes [BR:tcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tcur_1671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1958660..1960021)
Genome map
AA seq 453 aa AA seqDB search
MADETGSTKILLDESRIPRRWYNVVADLPAPPPPPLHPGTREPVGPEDLAPLFPIDLIEQ
EVSLERYLDIPEEVREVYRLWRPTPLYRARRLEKALGTPARIYYKYEGVSPSGSHKPNTA
VPQAFYNAKHGIRRLTTETGAGQWGSSLAFACSMYGLECEVWMVRASYDQKPYRRLMMET
YGARVHASPSPLTTAGAKILAEDADSPGSLGIAISEAVEVAAGADDTRYALGSVLNHVLL
HQTVIGEEALEQLASVGETPDVIVGCTGGGSNFAGLIFPFLREKLAGRIDPVLRAVEPAA
CPSLTRGRYEYDFGDTAGLTPLMKMHTLGHDFVPDPIHAGGLRYHGMAPLLSHIYELGLF
EAVAKRQRECFEAGILFARAEGIVPAPEGTHALAGAIEEARRCAETGEEKVILTALSGHG
HFDMSSYERYLSGEMEDFDLPQERIEQSLARLP
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacgaaacggggtcgaccaagatcctgctggacgagtcgcgcatcccgcgccgg
tggtacaacgtggtcgccgacctgccggcgccgccgcccccgccgctgcacccggggacg
cgggagccggtggggccggaggacctggcgccgctgttccccatcgacctcatcgagcag
gaggtcagcctggagcgctacctggacatccccgaggaggtccgggaggtctaccggctg
tggcggccgaccccgctgtaccgggcccggcggctggagaaggcgctgggcaccccggcg
cggatctactacaagtacgagggcgtctccccgtccggctcgcacaagcccaacaccgcc
gtcccgcaggcgttctacaacgccaagcacggcatccggcggctgaccaccgagaccggg
gccgggcagtggggcagctcgctggcgttcgcctgctcgatgtacgggctggagtgcgag
gtgtggatggtccgcgcctcctatgaccaaaagccctaccggcggctgatgatggagacc
tacggcgcccgggtgcacgccagtccctcgccgctgaccacggcgggcgccaagatcctg
gccgaggacgccgactcccccggctcgctgggcatcgccatcagcgaggccgtggaggtc
gccgccggcgccgacgacacccgctacgccctgggcagcgtgctcaaccacgtgctgctg
caccagacggtgatcggcgaggaggcgctggagcagctggcctcggtcggcgagaccccg
gatgtgatcgtcggctgcaccggcggcggctccaacttcgccgggctgatcttcccgttc
ctgcgcgagaagctggccgggcggatcgacccggtgctgcgcgcggtggagccggcggcc
tgcccgtcgctgacccggggccgctatgagtacgacttcggcgacaccgccgggctcacc
ccgctgatgaagatgcacaccctcgggcacgacttcgtccccgaccccatccacgccggc
gggctgcgctaccacggcatggcgccgctgctgtcgcacatctacgagctgggcctgttc
gaggccgtggccaagcggcagcgcgagtgcttcgaggcgggcatcctgttcgcccgcgca
gaaggcatcgtcccggcccccgagggcacccacgccctggccggggccatcgaggaggcc
cgccgctgcgccgagaccggcgaggagaaggtcatcttgaccgccctgtccggccacggc
cacttcgacatgagctcgtacgagcgctacctgtccggcgagatggaggacttcgacctg
ccgcaggagcgcatcgagcagtccctggcccgcctgccgtga

DBGET integrated database retrieval system