KEGG   Thermomonospora curvata: Tcur_1738Help
Entry
Tcur_1738         CDS       T01127                                 

Definition
glycoside hydrolase family 6
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tcu  Thermomonospora curvata
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tcur_1738
Enzymes [BR:tcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Tcur_1738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2032869..2034128
Genome map
AA seq 419 aa AA seqDB search
MAPPRGAPAPVRARLRAWSARCAALATAAALTAAAAPPAQAHAAGNPLQGPRAAKVRFFV
EPDTNAGRQARVWAAQGRFHDAALMRALSKISQAVWFTEGTPQQVQRRVRETMRQARRQG
AVPVLVAYYVPGRDCSQYSAGGAPSERAYREWINAFARGIGGGRAVVIVEPDGLALLSSE
PWCNEGGGGSTGRPEDMSLVEQRFREIDHAITTFAKLPNTGVYVDAGHSAWQPLNDYDAG
YGEPRAQLGIVSRLLRGGVAKADGFVLNVSNYRADAELIDYGVRVSKCLWLRRSTGAREC
TDADLAAVPDGRRDLTPFVLDTSRNGRGPWTAPEGAYPDPQEWCNPPGRGLGVRPTTRTG
HRLVDAFLWVKRPGESDGQCTRGTAGPQDPEYGIVDPPAGQWWPEYALGLARRAVPPLK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcaccccctcgcggcgccccggcccccgtgcgcgcccggctgcgcgcctggtcggcc
cgctgcgccgcgctcgcgaccgcggcggccctcaccgccgcagcggcgccgcccgcccag
gcgcatgccgccggcaaccccctgcagggcccgagggcggcgaaggtccgcttcttcgtc
gaacccgacaccaacgccggacggcaggcccgggtgtgggccgcgcagggacgcttccac
gacgccgccctcatgcgggcgctgtcgaagatctcccaggcggtctggttcaccgaggga
actccccagcaggtgcagcggcgggtccgcgagaccatgcgccaggcccgccgccaaggc
gccgtccccgtgctggtggcctactacgtgccgggacgggactgctcgcagtactcggcc
ggcggcgcccccagcgagcgggcctaccgggagtggatcaacgccttcgcccgcggcatc
ggcggcggccgggccgtggtgatcgtcgaacccgacgggctggccctgctgtccagcgag
ccgtggtgcaacgaaggcggcggcggctccaccggccggccggaggacatgtcgctggtc
gagcagcgcttccgggagatcgaccacgccatcaccaccttcgccaagctccccaacacc
ggcgtgtacgtggacgccggccactcggcctggcagccgctcaacgactacgacgccggc
tacggcgagccgcgcgcccagctcggcatcgtcagccgcctgctgcgcggcggcgtcgcc
aaggccgacgggttcgtgctgaacgtctccaactaccgggccgacgccgagctgatcgac
tacggcgtccgggtctccaagtgcctgtggctgcgccgcagcaccggcgcgcgcgagtgc
accgacgccgacctggccgccgtgcccgacggccggcgcgacctgacccccttcgtcctg
gacaccagccgcaacggccgggggccgtggacggcgccggagggcgcgtaccccgacccc
caggagtggtgcaacccgcccggccgcggcctgggcgtccgccccaccacccgcaccggc
caccgcctggtggacgccttcctgtgggtcaaacggcccggcgagtccgacggccagtgc
acccgcggcaccgccggaccgcaggaccccgagtacggcatcgtcgacccgcccgcgggc
cagtggtggcccgagtacgccctgggcctggcccggcgggccgtgccacccctcaagtga

DBGET integrated database retrieval system