KEGG   Thermomonospora curvata: Tcur_1743Help
Entry
Tcur_1743         CDS       T01127                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tcu  Thermomonospora curvata
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcur_1743
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcur_1743
   00052 Galactose metabolism
    Tcur_1743
   00500 Starch and sucrose metabolism
    Tcur_1743
   00520 Amino sugar and nucleotide sugar metabolism
    Tcur_1743
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tcur_1743
   00524 Butirosin and neomycin biosynthesis
    Tcur_1743
Enzymes [BR:tcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tcur_1743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2040337..2041317
Genome map
AA seq 326 aa AA seqDB search
MTAMAPSAERPWLVADIGGTNARFGLIQAPGAPPSRVQVLALRDHAGLAEATATYLARHA
GDVRPGAACVAVAGPVTDDGRFQLTNAHWSGSAEEVRADLGLDHVELINDFEALALALPT
LQPGDLRVLGERAPGGQTPAAVLGPGTGLGVAALVRAGERLVAIPSEGGHVDLPATTPRE
LELAAMLREEHGTAEAERLLSGEGMTRLYELIARMHAVPVQPLSAAQICARRSDPLCQET
LETFCALLGSFAGNVALTFGARGGVYLGGGILPRIWDVLRRSDFRRRFESKPPMERYLRA
IPTALIVAPTPALAGAAARLASLEPV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgatggcgccttcggcggagcggccctggctggtggccgacatcggcggcacc
aacgcccgcttcgggctcatccaggcgcccggcgcgccgcccagccgggtgcaggtgctg
gcgctgcgcgaccacgccgggctggccgaggccaccgccacctacctggcccggcacgcc
ggggacgtgcggcccggcgccgcctgcgtggccgtcgccgggccggtcaccgacgacggc
cgcttccagctgaccaacgcccactggtccggcagcgccgaggaggtccgcgccgatctg
gggctggaccatgtggaactgatcaacgacttcgaggcgctggcgctggcgctgcccacc
ctgcagcccggcgacctgcgcgtgctgggcgagcgggcgcccggcggccagacccccgcg
gcggtgctcgggccgggcaccgggctgggggtggccgccctggtgcgggccggggagcgg
ctggtggcgatccccagcgagggcggccatgtcgacctgcccgccaccaccccccgcgag
ctggaactggcggcgatgctgcgggaggagcacggcaccgccgaggccgagcggctgctg
tcgggggaggggatgacccggctgtatgagctgatcgcccggatgcacgcggtgccggtc
cagccgctgtcggccgcccagatctgcgcccgccgcagcgacccgctgtgccaggagacg
ctggagaccttctgcgccctgctgggctccttcgccgggaacgtggcgctgaccttcggc
gcccgcggcggcgtctacctcggcggcggcatcctgccgcgcatctgggacgtgctgcgc
cgcagcgatttccgccgccggttcgagtccaagccgcccatggaacgctatctgcgggcc
atccccaccgccctcatcgtcgccccgacccccgcgctggcgggggccgccgcccgtctg
gcctccctggagccggtgtga

DBGET integrated database retrieval system