KEGG   Thermomonospora curvata: Tcur_1765Help
Entry
Tcur_1765         CDS       T01127                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tcu  Thermomonospora curvata
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tcur_1765
Enzymes [BR:tcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Tcur_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2069639..2071120
Genome map
AA seq 493 aa AA seqDB search
MERPGWTQGPSRPHVVVVGGGIAGLSAARFLVHGGARVTVLEGGPQIGGKLRVSRVAGLP
VDEGAESLLTRRPEGMELLRELGVAQRQVHPAVSGSAIYSRGALRPLPSGQMMGVPADLR
ALAASRILSPAALARAALDLVLPKTPLGSDVSVAGYIGARLGPEVVDRLVEPLLGGVYAG
RAEELSLEATLAPIAAAARTHRSLIAAVRSLNGAAPKGAGPVFASLPEGIGALPALLADS
MGTDCRIRTRAMVRHLARQPDGTWRLTFGSAHQPERLDADAVVLAVPAQPAARLLAEEVP
AAARELAGIEYASMAIVTLVYPAAAFPRRPTVSGYLVPAVEGRQVKAVTFSSVKWPQLAE
QAPDLMVVRCSIGRFGEEHLLQRSDEELKAAAIAELAQVCGVGGLPVDSRVTRWGGALPQ
YAVGHADRVARIRAAVAAVPGLAVAGAAYDGLGIPACIATARAAASRVLRELESRGGRDH
DHREHRSAEDARR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggagcgccccggctggacgcaagggccgtcgcggcctcatgtcgtggtcgtcggcggc
gggatcgcggggctgagcgcggcccgtttcctggtccacggcggggcgcgcgtcaccgtg
ctggagggcggcccgcagatcggcggcaagctgcgggtcagccgggtcgccgggctgccg
gtggacgagggcgccgagtcgctgctgacgcgccgccccgagggcatggagctgctgcgc
gagctgggcgtggcgcagcggcaggtgcacccggcggtgagcggctcggccatctacagc
cgcggcgcgctgcgccccctgcccagcggccagatgatgggcgtgcccgccgacctgcgg
gcgctggcggcctcgcggatcctgtccccggccgccctggcccgcgccgccctggatttg
gtgctgccgaagaccccgctgggctcggacgtgtcggtggccggctacatcggcgcgcgc
ctgggcccggaagtggtcgaccggctggtcgagccgctgctgggcggcgtgtacgccggg
cgggccgaggagctgtcgctggaggccacgctggcgccgatcgccgccgcggcgcgcacc
caccgttcgctgatcgccgccgtgcgcagcctcaacggcgcggcgcccaaaggcgccggc
ccggtgttcgcctcgctgccggaggggatcggagccctgcccgccctgctggccgactcg
atgggaaccgactgccggatccgcacccgggcgatggtgcggcacctggcccggcagccg
gacggcacctggcggctgaccttcgggtcggcccatcagcccgaacggctggacgccgat
gcggtggtgctggccgtcccggcgcagccggcggcgcggctgctggccgaggaggtcccg
gcggccgcccgggagctggccgggatcgagtacgccagcatggccatcgtcaccctggtc
tacccggcggccgccttcccgcgccggcccacggtcagcgggtacctggtgcccgccgtc
gagggacgtcaggtcaaggcggtgacgttcagctcggtgaagtggccgcagctggccgag
caggccccggacctgatggtggtgcgctgttccatcgggcgtttcggcgaagagcacctg
ctgcagcgctccgacgaggagctgaaggccgctgcgatcgccgagctggcccaggtgtgc
ggggtcggcgggctgccggtggacagccgcgtcacccgctggggcggggcgctgccgcag
tacgcggtgggccacgccgaccgggtggcccgcatccgcgccgcggtggccgccgtgccc
gggttggcggtggcgggcgcggcctacgacgggctgggcatcccggcgtgcatcgccacc
gcgcgggcggcggcgagccgggtgctgcgggaactggagagccgaggaggaagggaccat
gaccaccgagaacaccgaagcgccgaagacgcgcggcgctaa

DBGET integrated database retrieval system