KEGG   Thermomonospora curvata: Tcur_1812Help
Entry
Tcur_1812         CDS       T01127                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tcu  Thermomonospora curvata
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Tcur_1812
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Tcur_1812
Enzymes [BR:tcu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Tcur_1812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2120615..2121103
Genome map
AA seq 162 aa AA seqDB search
MSVYDVEIQDLRGGPADLAQYRGKAMLVVNVASRCGLTPQYKGLQELHERYAERGFTVLG
VPCNQFLEQEPGTHEEIAEFCSVNYGVTFPLTEKIEVNGEGRHPLYRELVDVPDATGYTG
DIRWNFEKFLIGPDGSVLARFAPQTEPDDEQLVAAIERALPR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtctacgacgttgagatccaggacctgcggggcggcccggccgacctcgcccag
taccgcggcaaggccatgctggtggtcaatgtcgcctccagatgcggcctgaccccgcag
tacaaggggttgcaggagctgcacgagcggtacgccgaacgcggcttcaccgtgctggga
gttccctgcaaccagttcctggagcaggagcccggcacccatgaggagatcgccgagttc
tgctcggtcaactacggcgtcaccttccccctgaccgagaagatcgaggtcaacggggag
ggcaggcacccactgtaccgggagctggtggatgtccccgacgccaccggctacaccggc
gacatccgctggaacttcgagaagttcctgatcggcccggacggctcggtgctggcgcgc
ttcgccccgcagaccgagccggacgatgagcagctggtggcggcgatcgaacgggccctg
ccccgctga

DBGET integrated database retrieval system