KEGG   Thermomonospora curvata: Tcur_1876Help
Entry
Tcur_1876         CDS       T01127                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tcu  Thermomonospora curvata
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tcu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2201695..2202339
Genome map
AA seq 214 aa AA seqDB search
MLLEDERRELCEIGRKMVDTGLVLGAAGNISVRRGDLVAVSPAGMRLERMTPADCPVIDL
TGAVVEGEREPSSETPMHLAVYEATGAPAIVHTHSTYAAVVATTLTELPPLHYNTLLLGG
IVKVAEYATYGTPELAANVRKAMDGGMRAALMANHGGVTIGADLEDAFENARLLEWLCGL
YVRAKSIGEPRVLTSEQLRRVTERGLRPRPLPAD
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggacgaacgccgggagctgtgcgagatcggccgcaagatggtcgacacc
gggctggtcctgggcgccgccggcaacatcagcgtgcgccggggcgacctggtggcggtc
tccccggccgggatgcgcctggagcgcatgacccccgccgactgcccggtgatcgacctg
acgggcgccgtcgtcgaaggcgagcgggaaccgtcctcggagacccccatgcacctggcg
gtctacgaggccaccggggccccggcgatcgtgcacacccactccacctacgccgcggtg
gtggccacgaccctgaccgagctgcccccgctccactacaacaccctgctgctcggcggg
atcgtcaaggtcgccgaatacgccacctacggcacgcccgaactggccgccaacgtccgc
aaggcgatggacggggggatgcgggcggcgctcatggccaaccacggcggcgtcaccatc
ggcgccgacctggaggacgccttcgagaacgcccggctgctggagtggctgtgcggcctt
tacgtgcgcgccaagtccatcggcgaaccccgcgtcctcaccagtgagcaactgcgccgg
gtcaccgaacgcggcctgcgcccccgcccgctgcccgccgattga

DBGET integrated database retrieval system