KEGG   Thermomonospora curvata: Tcur_1959Help
Entry
Tcur_1959         CDS       T01127                                 

Definition
Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tcu  Thermomonospora curvata
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Tcur_1959
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Tcur_1959
Enzymes [BR:tcu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Tcur_1959
Lipid biosynthesis proteins [BR:tcu01004]
 Desaturase
  First
   Tcur_1959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2316918..2317889
Genome map
AA seq 323 aa AA seqDB search
MTPAASSRETESAPLENLHAPQPVGPLEAEVQAPWERALVGVFIAAPLLALCAAVPVAWG
WGLSWRDVVIAAVLYVITGFGITVGYHRHFTHGSFKAPRPVRIALGIAGSMALEGPIVRW
VADHRKHHQYSDREGDPHSPWKYGRSPLGLARGLLHAHMGWMFDRERTSRRRYAPDMLAD
RDVMWMSRLFPLWVALSLLLPAAVGGLWSWSWQGALTAFFWGGLVRIGLVHQVTWAVNSV
CHVFGKQQFKTRDRSTNVWWLALPSFGESWHNLHHAEATSARHGVLRGQLDPSARLIRIM
ERLRLARDVRWPDPARIAAKRIA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccggccgcaagcagtcgcgagaccgagagcgccccgctggagaacctgcacgcg
ccccagccggtgggacctcttgaagcggaggtccaggccccctgggagcgggccctggtg
ggggtgttcatcgccgccccgctgctggcgctgtgcgccgccgtcccggtggcctggggg
tgggggctgagctggcgggacgtggtgatcgccgccgtgctgtatgtgatcaccgggttc
ggcatcaccgtcggctaccaccgccacttcacccacgggtccttcaaggcgccgcgcccg
gtgcggatagcgctgggcatcgccggcagcatggcgctggaaggcccgatcgtccgctgg
gtcgccgaccatcgcaagcaccaccagtactccgaccgcgagggcgacccccactcgccc
tggaagtacggccgctcccccctcggcctggcccgcgggctgctgcacgcccacatgggc
tggatgttcgaccgtgagcggacctcccgccgccgctacgcccccgacatgctggccgac
cgggacgtgatgtggatgtcccggctgttcccgctgtgggtggcgctgtcgctgctgctg
ccggcggcggtgggcggcctgtggtcgtggtcctggcagggggcgctgaccgccttcttc
tggggcggcctggtgcgcatcggcctggtccaccaggtgacctgggcggtcaactccgtc
tgccacgtgttcggcaagcagcagttcaaaacccgcgaccgctccaccaacgtgtggtgg
ctggcgctgccgtccttcggcgagtcctggcacaacctgcaccacgccgaggccaccagc
gcccggcacggggtgctgcgcggccagctcgaccccagcgcccgcctgatccgcatcatg
gagcggctgcgcctggctcgcgacgtgcgctggcccgaccccgcccggatcgccgccaaa
cggatcgcctga

DBGET integrated database retrieval system