KEGG   Thermomonospora curvata: Tcur_1959Help
Entry
Tcur_1959         CDS       T01127                                 

Definition
Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tcu  Thermomonospora curvata
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tcu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:tcu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2316918..2317889
Genome map
AA seq 323 aa AA seqDB search
MTPAASSRETESAPLENLHAPQPVGPLEAEVQAPWERALVGVFIAAPLLALCAAVPVAWG
WGLSWRDVVIAAVLYVITGFGITVGYHRHFTHGSFKAPRPVRIALGIAGSMALEGPIVRW
VADHRKHHQYSDREGDPHSPWKYGRSPLGLARGLLHAHMGWMFDRERTSRRRYAPDMLAD
RDVMWMSRLFPLWVALSLLLPAAVGGLWSWSWQGALTAFFWGGLVRIGLVHQVTWAVNSV
CHVFGKQQFKTRDRSTNVWWLALPSFGESWHNLHHAEATSARHGVLRGQLDPSARLIRIM
ERLRLARDVRWPDPARIAAKRIA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccggccgcaagcagtcgcgagaccgagagcgccccgctggagaacctgcacgcg
ccccagccggtgggacctcttgaagcggaggtccaggccccctgggagcgggccctggtg
ggggtgttcatcgccgccccgctgctggcgctgtgcgccgccgtcccggtggcctggggg
tgggggctgagctggcgggacgtggtgatcgccgccgtgctgtatgtgatcaccgggttc
ggcatcaccgtcggctaccaccgccacttcacccacgggtccttcaaggcgccgcgcccg
gtgcggatagcgctgggcatcgccggcagcatggcgctggaaggcccgatcgtccgctgg
gtcgccgaccatcgcaagcaccaccagtactccgaccgcgagggcgacccccactcgccc
tggaagtacggccgctcccccctcggcctggcccgcgggctgctgcacgcccacatgggc
tggatgttcgaccgtgagcggacctcccgccgccgctacgcccccgacatgctggccgac
cgggacgtgatgtggatgtcccggctgttcccgctgtgggtggcgctgtcgctgctgctg
ccggcggcggtgggcggcctgtggtcgtggtcctggcagggggcgctgaccgccttcttc
tggggcggcctggtgcgcatcggcctggtccaccaggtgacctgggcggtcaactccgtc
tgccacgtgttcggcaagcagcagttcaaaacccgcgaccgctccaccaacgtgtggtgg
ctggcgctgccgtccttcggcgagtcctggcacaacctgcaccacgccgaggccaccagc
gcccggcacggggtgctgcgcggccagctcgaccccagcgcccgcctgatccgcatcatg
gagcggctgcgcctggctcgcgacgtgcgctggcccgaccccgcccggatcgccgccaaa
cggatcgcctga

DBGET integrated database retrieval system