KEGG   Thermomonospora curvata: Tcur_2110Help
Entry
Tcur_2110         CDS       T01127                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tcu  Thermomonospora curvata
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tcur_2110
Enzymes [BR:tcu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tcur_2110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2474488..2475096
Genome map
AA seq 202 aa AA seqDB search
MIAFVSGKVAAAGPDHAVVDVGGVGLTLQCTPATLAGLRVGEQVTVPTSLVVREDSLTLF
GFADDDERAVFELLQTASGVGPRLALAMLAVHSPNALRRAVAAGDVAALTKVPGIGKKGA
QRIVLELKDRLGAPSGEEEAAAPAPARAEPWRTQVQTGLINLGWSAREAEAAVEAVAAEL
DGGPLPPVSALLKSALRKLSKP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctttgtcagcgggaaggtggccgccgccgggcccgaccacgccgtcgtggac
gtgggcggggtggggctgaccctgcagtgcacccccgccacgctggccggcctgcgggtc
ggcgagcaggtcaccgtccccacctccctggtggtgcgggaggactccctgacgctgttc
ggcttcgccgacgacgacgagcgcgccgtcttcgagctgctgcagaccgccagcggcgtc
ggcccccgcctggcgctggcgatgctggcggtgcacagccccaacgcgctgcgccgggcg
gtggccgccggggacgtggccgctctcaccaaggtccccggcatcggcaagaaaggcgcc
cagcgcatcgtgctggaactgaaagaccggctcggcgctcccagcggggaggaggaggcc
gccgcgcccgcccctgcccgcgccgaaccctggcgcacccaggtccagaccgggctgatc
aacctcggctggtcggccagggaggccgaggccgccgtggaggccgtcgccgccgagctc
gacggcggccccctccccccggtgtccgccctgctgaagtccgcgctgcgtaagctcagc
aagccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system