KEGG   Thermomonospora curvata: Tcur_2200Help
Entry
Tcur_2200         CDS       T01127                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tcu  Thermomonospora curvata
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcur_2200
   01230 Biosynthesis of amino acids
    Tcur_2200
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcur_2200
   00051 Fructose and mannose metabolism
    Tcur_2200
   00562 Inositol phosphate metabolism
    Tcur_2200
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tcur_2200
Enzymes [BR:tcu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tcur_2200
Exosome [BR:tcu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tcur_2200
  Exosomal proteins of bladder cancer cells
   Tcur_2200
  Exosomal proteins of melanoma cells
   Tcur_2200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2583232..2584029
Genome map
AA seq 265 aa AA seqDB search
MATAKKPSRKPIMAGNWKMNNNHLEAIKLVQQLAFALKEADYEAVEVVVLPPFTAIRSVQ
TLVDADKLPIAYGAQDVSAHASGAYTGEISGSMLAKLGCTYVVVGHSERRQYHHEDDALV
NAKIKAAFAAELTPILCVGEGLEVRKAGEHVPYTLSQVDGALEKIPAEQARSLVIAYEPV
WAIGTGEVATPADAQEVCSAIRGRLAELYDEEVASQVRIQYGGSVKSGNIAGIMAQPDVD
GALVGGASLDAGEFVKICRYRDLPV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccactgccaagaaaccttcccgtaagccgatcatggccggcaactggaagatgaac
aacaaccacctggaggcgatcaagctcgtccagcagctcgccttcgccctcaaggaggcc
gactacgaggcggtcgaggtggtggtgctgccgccgttcaccgcgatccgctcggtgcag
acgctggtggacgccgacaagctgccgatcgcctacggcgcccaggacgtctccgcgcac
gcctccggggcctacaccggcgagatctccgggtccatgctggccaagctgggctgcacg
tacgtggtggtgggccactcggagcgccgccagtaccaccatgaggacgacgccctggtc
aacgccaagatcaaggccgccttcgccgccgagctgaccccgatcctgtgcgtgggggag
ggcctggaggtgcgcaaggccggcgagcacgtcccctacaccctgtcccaggtcgacggg
gcgctggagaagatccccgccgagcaggcccggtccctggtgatcgcctacgagccggtc
tgggcgatcggcaccggcgaggtcgccaccccggccgacgcccaggaggtgtgctcggcc
atccgcggccggctcgccgagctgtacgacgaggaggtggcctcccaggtccgcatccag
tacggcgggtcggtcaagtccggcaacatcgccggcatcatggcccagccggacgtggac
ggcgcgctggtcggcggggccagcctggacgccggcgagttcgtcaagatctgccggtac
cgggacctgccggtgtga

DBGET integrated database retrieval system