KEGG   Thermomonospora curvata: Tcur_2410Help
Entry
Tcur_2410         CDS       T01127                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tcu  Thermomonospora curvata
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tcur_2410
Enzymes [BR:tcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Tcur_2410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2804090..2805262)
Genome map
AA seq 390 aa AA seqDB search
MNTDHEPLAGFAVGVTAARRHEELAALLERRGARVVHAPAIRLVPLADDAELLHATNVCI
ADRLDYVVVTTAIGFRAWLETADGWGLRDALIERLHKARILARGPKARGAIRSAGLQEEW
SPDSESCQELLRHLLAEDLTGTRIAVQLYGEPLPDFTGALRAAGAEVIEVPVYRWSRTDD
STPLRRLVGQAVAGTIDAITFTSAPAVTATLAVAAEDGLEEALLEALRTHTVAACVGPVT
AQPLTDRGVPTVQPERARIGALVRALAADLPRRRARRINVRGHTLELRGHAVVLDGQLRP
IAPAPMAILRALARRPGHVVSRAELCTVLPSRVITGSGWGRDGRPQADEHAVEMAVARLR
RGLGRSGIVETVVKRGYRLACDPVRTDRPF
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgaccatgaaccgctcgccgggttcgcggtcggggtgaccgcggcacggcgg
cacgaggagttggccgcgctgctggaacggcgcggggcacgggtggtgcacgcccccgcg
atccggctggtgccgctggccgacgacgccgaactgctgcacgccaccaacgtgtgcatc
gccgacaggctcgactatgtcgtcgtcaccaccgccatcggtttccgcgcctggctggag
acggccgacggctgggggctgcgcgacgccttgatcgagcggctgcacaaggcccgcatc
ctggcccgcggccccaaggcccgcggcgccatccgctcggcgggcctgcaggaggagtgg
tcgccggattcggaaagctgccaggagctgctgcgtcacctgctggccgaggacctgacc
ggcacccgcatcgcggtgcagctgtatggggagccgctgccggacttcaccggcgcgctg
cgcgccgccggcgccgaggtgatcgaggtgccggtctaccgctggtcgcgcaccgacgac
tccacgccgctgcgccggctggtggggcaggccgtggccggcaccatcgacgccatcacc
ttcaccagcgcccccgccgtcaccgccacgctggcggtggcggccgaggacggcctggag
gaggcgttgctggaggcgctgcgcacccacacggtggccgcctgcgtcggcccggtcacc
gcccagccgctgaccgaccgcggcgtacccaccgtccagcccgagcgggccaggatcggg
gcgctggtgcgggcgctggccgccgacctgccgcggcggcgggcccggcggatcaacgtc
cgcggccacaccctggagctgcgcgggcacgccgtcgtgctggacgggcagctgcggccg
atcgccccggcgccgatggcgatcctgcgggcgctggcccgccggcccggccatgtggtc
tcccgggccgagctgtgcacggtgctgcccagccgggtgatcaccggaagcggctggggc
cgggacggccgcccgcaggccgatgagcacgcggtggagatggcggtggcccggctgcgg
cgcggcctgggccgctcgggcatcgtggagaccgtggtcaaacgcggctaccggctggcc
tgcgacccggtacgcaccgatcgtcccttttga

DBGET integrated database retrieval system