KEGG   Thermomonospora curvata: Tcur_2733Help
Entry
Tcur_2733         CDS       T01127                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tcu  Thermomonospora curvata
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tcur_2733
Enzymes [BR:tcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Tcur_2733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3185772..3188060
Genome map
AA seq 762 aa AA seqDB search
MADVDERRPLPEAVASGAVRGESVLEGVLERITFVNEETGYTIARIATERSGNELLTVVG
PLHGAQVGESLRLRGRWTSHAKYGRQFQVHSFTTVLPATVQGLRRYLGSGLIKGIGPTMA
ERMVDHFGTDILRVIEEEPERLTEVYGLGPKRMRRIAEAWEEQKAIKEVMVFLSEVGVST
SLAVRIYKTYGDDAIEVVRKEPYRLAADVWGIGFKTADTIAQAVGIPHDSPERIKAGLRY
TLSQAADAGHCYLPEPNLLSETAKILQVDAEQVGPCLEELVAEEGVVRETVRTTGGNQVP
AVYLLPFYRAECSLAAALLGLLRCDADRLAAFGDVDWEAALGWLARRTGQQLADEQRQAV
QLALTRKVAVLTGGPGCGKSFTVRSVVELAKAKKATVLLVAPTGRAAKRLAELTGHEAST
VHRLLELQPGGDPKYDRDHPLQADLVVVDECSMLDLVLANKLVKAIPPGAHLLLVGDVDQ
LPSVGAGEVLRDLLAADVIPHVRLTKIFRQAQQSGIVVNAHKINAGRPPALTGFSDFFWF
GCEPPADSGLNPAEETAKLVVDIVARRIPARFGLDPRRDVQVLTPMHRGPAGAASLNALL
QEALTPYREGVPERRHGGRVFRPGDKVTQLRNNYDKGKAGIFNGTVGVVTGLSLEDGTLT
VVTDEDETVDYDFAELDELAHAYAVTIHRSQGSEYPAVVVPITMSAWTMLQRNLLYTAVT
RARKLVVLVGSRRALAVAVRTPGTGRRHTALAHRLQPAPLPE
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgtggatgagcggcgtcccttgcccgaggctgttgcgtccggggcggtgcgg
ggcgagtcggtgctggaaggggtgctggagcgcatcaccttcgtcaacgaggagaccggg
tacaccatcgcgcgcatcgccaccgagcggtcggggaatgagctgctgaccgtggtgggg
ccgctgcatggggcccaggtcggcgaaagcctgcggctgcgggggcggtggacctcccat
gccaagtacgggcggcagtttcaggtgcactcgttcaccacggtgctgccggccaccgtc
caggggctgcggcggtacctgggatcggggctgatcaaggggatcgggccgacgatggcc
gagcggatggtcgatcacttcgggaccgacatcctgcgggtcatcgaagaggagcccgag
cggctgaccgaggtgtacgggctggggcccaagcggatgcggcggatcgccgaggcctgg
gaagagcagaaggccatcaaagaggtgatggtgttcctgtcggaggtgggggtgtccacc
tccctggcggtccgcatctacaagacttacggggacgacgccatcgaggtggtgcgcaag
gagccctaccggctggccgccgatgtgtggggcatcgggttcaagaccgccgacaccatc
gcccaggcggtcggcattccgcacgacagcccggagcggatcaaggccgggttgcggtac
acgctctcgcaggccgccgacgccgggcactgctacctgccggagccgaacctgctgagt
gagaccgccaagatcctccaggtggacgccgagcaggtcgggccctgcctggaggagctg
gtcgccgaggaaggggtggtgcgggagacggtgcgcaccaccggcggcaaccaggtcccg
gcggtgtatctgctgccgttttaccgggccgaatgttcgctggccgcggcgctgctgggg
ctgctgcgctgcgatgccgaccggctggccgccttcggcgatgtggactgggaggcggcg
ctgggctggctggcccggcgcaccgggcagcagctggccgacgagcagcggcaggcggtg
cagctggcgctcacccgcaaggtcgcggtgctgaccggtggaccgggctgcggcaagagc
ttcaccgtccggtcggtggtggagctggccaaggccaagaaggccaccgtgctgctggtc
gcccccaccggccgcgccgccaagcggctggcggagctgaccgggcacgaggcctccacc
gtgcaccggctgctggagctgcagcccggcggggaccccaagtacgaccgcgaccacccg
ctccaggccgacctggtcgtggtggacgagtgctccatgctggatctcgtcctggccaac
aagctcgtcaaggccatcccgcccggggcgcacctgctgctggtgggggatgtggaccag
ctcccctcggtgggcgccggggaggtgctgcgcgacctgctggccgccgatgtcatcccg
cacgtgcggctgacgaagatcttccggcaggcccagcagtcggggatcgtggtcaacgcc
cacaagatcaatgcggggcggccgccggcactgaccggtttttcggacttcttctggttc
ggctgcgagccgcccgccgattcgggcctgaacccggccgaggagaccgccaagctggtg
gtcgatatcgtggcccgccgcatcccggcccgtttcgggctggacccccgccgtgacgtg
caggtcctcacccccatgcaccggggtccggcgggcgccgccagcctcaacgccctgctg
caggaggcgctcaccccttaccgggagggcgtccccgagcgccgccacggcggccgggtg
ttccggcccggcgacaaggtcacccagttgcgcaacaactatgacaagggcaaggcgggg
atcttcaacggcaccgtcggcgtcgtcaccgggctgtctttggaggacggcaccctcacc
gtcgtcaccgacgaggacgaaaccgtcgactacgacttcgccgagctcgatgagctcgcc
cacgcgtatgcggtgaccatccaccgctctcaaggcagcgaatatccggcggtggtcgtc
cccatcaccatgagcgcctggacgatgctgcagcgcaacctgctgtacacggccgtcacc
cgggcgcgcaagctcgtcgttttggtcgggtcccgccgcgccctggccgtcgccgtccgc
acgccgggaacgggccgccgccacaccgcgctcgcccaccggctccagccggccccgctt
cctgagtga

DBGET integrated database retrieval system