KEGG   Thermomonospora curvata: Tcur_2810Help
Entry
Tcur_2810         CDS       T01127                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00010  Glycolysis / Gluconeogenesis
tcu00071  Fatty acid degradation
tcu00350  Tyrosine metabolism
tcu00625  Chloroalkane and chloroalkene degradation
tcu00626  Naphthalene degradation
tcu01100  Metabolic pathways
tcu01110  Biosynthesis of secondary metabolites
tcu01120  Microbial metabolism in diverse environments
tcu01130  Biosynthesis of antibiotics
tcu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcur_2810
  Lipid metabolism
   00071 Fatty acid degradation
    Tcur_2810
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tcur_2810
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tcur_2810
   00626 Naphthalene degradation
    Tcur_2810
Enzymes [BR:tcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tcur_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 DapB_N
Motif
Other DBs
NCBI-ProteinID: ACY98355
UniProt: D1A6V1
Position
complement(3275014..3276063)
Genome map
AA seq 349 aa AA seqDB search
MRALRLMRWNSEPELVELPEPEPGPGQVVIRVGGAGACHSDLHLMHDFQPGQMPWDPPFT
LGHENAGWVHALGEGVTGLEIGQPVAVYGPWGCGFCERCRVGVETYCENTSASPAPGGGG
GLGADGGMSEFMLIPHPRFLVPLPDGLDPVSAAPITDAGLTPYHAIRRSWGKLPPGSTAV
VIGVGGLGHMGVQILKATTAARIIAVDTREAALKLALASGADQALLSGKDTAAEIRSATG
GRGADVILDFVGSDATLAMAGAAARMVGDITIVGIAGGTLPVSFFSPPYEVSVQSTYWGS
RPELIEVLDLAARGLVSPTIVTYPLERAVEAYRRLQAGELSGRAVITPS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcattgcggttgatgcggtggaactccgaaccggagctggtggagcttcccgag
cccgagcccggcccgggccaggtggtgatccgggtcggcggcgccggcgcctgccattcc
gacctgcacctgatgcacgacttccagcccggtcagatgccctgggacccgccgttcacc
ctcggccacgagaacgccggctgggtccatgcgctcggcgagggggtcaccgggctggag
atcgggcagccggtcgccgtctacggcccctgggggtgcggtttctgtgagcgctgccgg
gtcggcgtggagacctactgcgagaacacctcggcctcgccggcccccggcggcggtggc
gggctcggagccgacggcggcatgtccgagttcatgctcatcccgcatccccggttcctg
gttccgctgccggacgggctggacccggtgtcggccgcgccgatcaccgacgccgggctc
accccctaccacgcgatccgccgctcctggggcaagctcccgccgggcagcaccgccgtg
gtcatcggggtcggcgggctcggccacatgggggtgcagatcctcaaggcgacgaccgcc
gcccgcatcatcgcggtcgacacccgcgaggcggcgctcaaactcgccctggcctccggc
gccgatcaggccttgctctccgggaaggacaccgcggcggagatccgctcggccaccggg
ggccgcggcgccgatgtgatcttggatttcgtgggctccgacgccaccttggccatggcc
ggggccgcggcccggatggtcggcgatatcaccatcgtcggcatcgccggcggcacgctg
ccggtgtcgttcttctccccgccgtatgaggtctcggtgcagagcacctactggggcagc
cgcccggaactgatcgaggtcctcgacctggccgcccgcgggctggtcagcccgacgatc
gtcacctacccgctggagcgggcggtggaggcctaccggcggctgcaggccggggagctc
agcggacgcgccgtgatcaccccgtcctga

DBGET integrated database retrieval system