KEGG   Thermomonospora curvata: Tcur_2874Help
Entry
Tcur_2874         CDS       T01127                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tcu  Thermomonospora curvata
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tcur_2874
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tcur_2874
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tcur_2874
Enzymes [BR:tcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tcur_2874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3355402..3356676)
Genome map
AA seq 424 aa AA seqDB search
MTIDVARGAASAPVSLPDSAGRYGRFGGRFAPEALMAALDELTEQFQAAMADPAFTGELD
RLLADYAGRPSLLTEARRFSEHAGGARILLKREDLNHTGSHKINNVLGQALLTRRMGKKR
IIAETGAGQHGVATATAAALLGLECTVYMGEVDTRRQALNVARMRMLGAEVVPVTTGSRT
LKDAVNEAFRDWVATVDDTHYCIGSVMGPHPFPMMVRDFHRVIGTEARNQVLELTGRLPD
AVAACVGGGSNAIGIFHAFIPDAQVRLYGFEAGGDGVQTGRHAATLTGGSLGVIHGMRTF
LLQDEEGQTLETHSVSAGLDYPGVGPEHAWLHDTGRAVYQAVSDAEAMDAFALLCRTEGI
IPAIESAHALAGALRIGPQLAAELDEEPVIVVCLSGRGDKDMHTAARWFGFVTGEDVTGE
ENAQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgacgtcgcgcgcggcgccgccagcgcgcctgtgagccttcccgattccgcc
ggccgctacggccgcttcggcggcagattcgcccccgaagcgctgatggccgcgctcgat
gagctgaccgagcagttccaggccgccatggccgaccccgccttcaccggcgagctggac
cggctgctggccgactacgccggccggcccagcctgctcaccgaggcccgccgcttctcc
gagcacgccggcggcgcccgcatcctgctcaagcgcgaggacctcaaccacaccggctcc
cacaagatcaacaacgtgctggggcaggcgctgctgacccgccgcatgggcaaaaagcgg
atcatcgccgagaccggcgccggccagcacggcgtggccaccgccaccgccgccgccctg
ctggggctggaatgcaccgtctacatgggcgaggtcgacacccggcgccaggccctcaac
gtcgcccgcatgcggatgctcggcgccgaggtcgtcccggtcaccaccggcagccgcacc
ctcaaggacgccgtcaacgaggccttccgcgactgggtcgccaccgtggacgacacccac
tactgcatcggctcggtcatgggcccccacccgttcccgatgatggtccgcgacttccac
cgcgtcatcggcaccgaggcccgcaaccaggtgctggagctgaccggcaggctgccggac
gcggtcgccgcctgcgtgggcggcggctccaacgccatcggcatcttccacgccttcatc
cccgacgcccaggtgcggctgtacggctttgaggccggcggcgacggcgtgcagaccggc
cggcacgccgccaccctgaccggcggctccctgggcgtcatccacggcatgcgcaccttc
ctgctgcaggacgaggagggccagaccctggagacccactcggtgtcggccgggctggac
tacccgggcgtcggccccgagcacgcctggctgcacgacaccggacgcgccgtctaccag
gcggtcagcgacgccgaggcgatggacgccttcgccctgctgtgccgcaccgagggcatc
atcccggccatcgagtccgcccacgccctggccggggcgctgcggatcggcccgcagctg
gccgccgagctcgatgaggaaccggtcatcgtggtgtgcctgtcgggccgcggcgacaag
gacatgcacaccgccgcccgctggttcggcttcgtcaccggggaggacgtgacgggagag
gagaacgcccagtga

DBGET integrated database retrieval system