KEGG   Thermomonospora curvata: Tcur_2897Help
Entry
Tcur_2897         CDS       T01127                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tcu  Thermomonospora curvata
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tcur_2897
  Amino acid metabolism
   00340 Histidine metabolism
    Tcur_2897
Enzymes [BR:tcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Tcur_2897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3376482..3377789)
Genome map
AA seq 435 aa AA seqDB search
MISRIDLRGSLPGDLRSVLPRAELDVEAALERVRPICEDVRHRGAAAVREYTKKFDGVEL
ESLRVPAAALERALAGLDPAVRDALEESIRRARLVHRDQRRTDVTTQVVPGGTVTERWIP
VERVGLYVPGGRAVYPSSVVMNVVPAQEAGVGSLAVTSPPQQEFGGLPHPAILAACALLG
VEEVYAAGGAQSIAMLAYGTDECRPVNLVTGPGNIWVAAAKRHLRGVVGIDSEAGPTEIA
ILADASADPVHVAADLISQAEHDTLAAAVLVTDSEELAERVERELAEQVARTKHTERITQ
ALAGRQSGIVLVDDIEAGLAVVNAYAAEHLEIQTANARQVAERVRNAGAIFIGPHSPVSL
GDYLAGSNHVLPTGGCACHSSGLSVQSFLRGVHVVEYDRAALAEATARVVALAEAEDLPA
HGAAMKARFNWEIPT
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgatctcccgaatcgacctgcgcggttcgctgcccggcgacctgcgctccgtgctgccg
cgtgccgaactggacgtcgaggccgccctggagcgggtgcggcccatctgcgaggacgtg
cgccatcgcggcgcggcggcggtccgggagtacaccaagaagttcgacggggtggagctg
gagagcctgcgggtgcccgccgcggcgctggagcgggcgctggccgggctggacccggcc
gtgcgggacgcgctggaggagtccatccgccgcgcccgcctggtgcaccgcgaccagcgc
cgcaccgacgtcaccacccaggtggtgcccggcggcaccgtcaccgagcggtggatcccg
gtggagcgggtcgggctgtatgtgccgggcggccgggccgtctacccctccagcgtggtg
atgaacgtcgtccccgcccaggaggccggggtcggctcgctggccgtcacctccccgccg
cagcaggagttcggcggcctgccgcacccggcgatcctggccgcctgcgccctgctgggc
gtggaggaggtctacgccgccggcggtgcccagtccatcgcgatgctggcctacggcacc
gacgagtgccgcccggtcaacctggtcaccggccccggcaacatctgggtggccgccgcc
aagcgccacctgcggggcgtggtcggcatcgactccgaggccggccccaccgagatcgcc
atcctcgccgacgccagtgccgacccggtgcacgtggccgccgacctgatcagccaggcc
gagcacgacacgctggccgccgcggtgctggtcaccgacagcgaggagctggccgagcgg
gtggagcgggagctggccgagcaggtcgcccgcaccaagcacaccgagcgcatcacccag
gcgctggccggccggcagtccggcatcgtgctggtcgacgacatcgaggccgggctggcg
gtggtcaacgcctacgccgccgagcacctggagatccagaccgcgaacgcccggcaggtg
gccgagcgggtccgcaacgccggggcgatcttcatcggcccgcactcgccggtgtcgctg
ggcgactacctggccgggtccaaccacgtgctgcccaccggagggtgcgcctgccattcg
tcggggctgtcggtgcagtccttcctgcgcggcgtccatgtggtcgagtacgaccgcgcc
gcgctggccgaggccaccgcccgggtggtggcgctggccgaggccgaggacctgcccgcc
cacggagccgcgatgaaggcccgcttcaactgggagatccccacgtga

DBGET integrated database retrieval system