KEGG   Thermomonospora curvata: Tcur_3007Help
Entry
Tcur_3007         CDS       T01127                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00230  Purine metabolism
tcu01100  Metabolic pathways
Module
tcu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tcur_3007
Enzymes [BR:tcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Tcur_3007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_22 RsgA_GTPase AAA_25 AAA_29 MMR_HSR1 AAA_33 AAA_30 Rad17 Thymidylate_kin ABC_tran NB-ARC RNA_helicase AAA_23
Motif
Other DBs
NCBI-ProteinID: ACY98549
UniProt: D1A827
Position
complement(3493443..3494114)
Genome map
AA seq 223 aa AA seqDB search
MSAAAGSGLPEEKGARNGTTPPGSGAEPAAGGCAPSSPRRRLTVLSGPSGVGKSTVVTEI
RRSHPEVWLSVSVTTRPPRPGEKHGVQYFFVDDAGFDRLVADGELLEWAEFAGNRYGTPR
APVAEKLAAGVPVLLEIDLQGARQVRRAMPDALLVFLAPPSWDELVRRLVGRGTEPPEVI
ERRLEAARVELAAEKEFDVTLVNTSVQDVCRELLALMVDQTSD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcggccggttccggcctgcccgaggagaagggcgctcggaacggcaccacc
ccgcccggttccggcgccgagccggccgcgggcggatgcgcgccgtcctcgccgcggcgc
cgtctgaccgttctgtccgggccgtccggcgtcggcaagagcacggtggtcaccgagatc
cggcgatcgcacccggaggtgtggctgtcggtctcggtgaccacccggcccccccgcccg
ggggaaaagcacggcgtgcagtacttcttcgtcgatgatgccggttttgaccggctcgtc
gccgatggggaattgctggaatgggcggagttcgcggggaaccgctacgggaccccgcgg
gctccggtcgccgaaaagctcgccgcgggcgtgcccgtcctgctggaaatcgatctgcag
ggggcgcgtcaggtgcgccgggcgatgccggacgcgctgctggtgttcttggccccgccc
tcctgggacgagctggtgcgccgcctggtgggccgcggcaccgagccgccggaggtgatc
gagcgccggctggaggccgcccgcgtcgagctggccgccgaaaaagagttcgacgtcacc
ttggtcaacacatccgtccaggatgtgtgccgggagctgctagccttgatggtcgaccag
acttcggattag

DBGET integrated database retrieval system