KEGG   Thermomonospora curvata: Tcur_3043Help
Entry
Tcur_3043         CDS       T01127                                 

Definition
phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tcu  Thermomonospora curvata
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcur_3043
   01230 Biosynthesis of amino acids
    Tcur_3043
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcur_3043
   00030 Pentose phosphate pathway
    Tcur_3043
   00051 Fructose and mannose metabolism
    Tcur_3043
   00052 Galactose metabolism
    Tcur_3043
  Energy metabolism
   00680 Methane metabolism
    Tcur_3043
Enzymes [BR:tcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tcur_3043
Protein phosphatases and associated proteins [BR:tcu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tcur_3043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3529890..3530915)
Genome map
AA seq 341 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVVRKGISVYGYEFVGFRSGWRGPLEGDTVALDIQAVRGI
LPRGGTILGSSRTNPLKVEGGIERIKDNLAGLGVDALVAIGGEDTLGVAKHLHEAGVNVV
GVPKTIDNDLNATDYTFGFDTAVNIAVEAIDRLHTTAESHHRALICEVMGRHAGWIALHA
GMAAGANVILIPERPFDIDKVVEYVESRFKTRYAPIIVVAEGAHPIEGQMAVQSKELDAF
GHVRLGGIGQWLADEIEKRTGKEARCTVLGHIQRGGTPSAFDRVLATRFGLHAIDAVHDG
DYGKMVALSGTEIIRVDLSAATDTLKTVPLERYAEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcggagtgctgaccggaggcggtgactgccccggtctgaacgccgtgatccgc
gctgtggtgcgtaagggaatctcggtctacgggtatgagttcgtgggcttccggtcgggc
tggcgcggcccgctggaaggcgacacggtggcgctggacatccaggccgtgcggggcatc
ctgccgcgcggcgggacgatcctgggctcgtcgcggaccaacccgctcaaggtcgagggc
ggcatcgagcggatcaaggacaacctggccgggctcggtgtggatgcgctggtcgccatc
ggcggcgaggacaccctcggcgtcgccaagcatctgcacgaggccggcgtcaacgtggtc
ggggtccccaagaccatcgacaacgacctgaacgccaccgactacaccttcggcttcgac
accgccgtcaacatcgcggtggaggccatcgaccggctgcacaccaccgccgaaagccac
caccgcgccctgatctgcgaggtgatgggccggcacgccgggtggatcgcgctgcacgcc
gggatggccgccggcgccaacgtgatcttgattccggagcggccgttcgacatcgacaag
gtcgtcgagtacgtcgaaagccgcttcaagacccggtatgcgccgatcatcgtggtcgcc
gagggcgcccacccgatcgagggccagatggcggtgcagagcaaggaactggacgccttc
gggcacgtgcggctgggcggcatcggccagtggctggccgacgagatcgaaaagcgcacc
ggcaaggaggcccgctgcaccgtgctgggccacatccagcgcggcggcacgcccagcgcc
ttcgaccgggtgctggccacccgcttcgggctgcacgccatcgacgccgtccacgacggc
gactacggcaagatggtcgccctgtcgggcaccgagatcatccgggtggacctgtcggcc
gccaccgacacgctcaagaccgtcccgctggagcgctacgccgaggcggaggtcttcttc
ggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system