KEGG   Thermomonospora curvata: Tcur_3043Help
Entry
Tcur_3043         CDS       T01127                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00010  Glycolysis / Gluconeogenesis
tcu00030  Pentose phosphate pathway
tcu00051  Fructose and mannose metabolism
tcu00052  Galactose metabolism
tcu00680  Methane metabolism
tcu01100  Metabolic pathways
tcu01110  Biosynthesis of secondary metabolites
tcu01120  Microbial metabolism in diverse environments
tcu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcur_3043
   00030 Pentose phosphate pathway
    Tcur_3043
   00051 Fructose and mannose metabolism
    Tcur_3043
   00052 Galactose metabolism
    Tcur_3043
  Energy metabolism
   00680 Methane metabolism
    Tcur_3043
Enzymes [BR:tcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tcur_3043
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Tcur_3043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACY98585
UniProt: D1A8U7
Position
complement(3529890..3530915)
Genome map
AA seq 341 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVVRKGISVYGYEFVGFRSGWRGPLEGDTVALDIQAVRGI
LPRGGTILGSSRTNPLKVEGGIERIKDNLAGLGVDALVAIGGEDTLGVAKHLHEAGVNVV
GVPKTIDNDLNATDYTFGFDTAVNIAVEAIDRLHTTAESHHRALICEVMGRHAGWIALHA
GMAAGANVILIPERPFDIDKVVEYVESRFKTRYAPIIVVAEGAHPIEGQMAVQSKELDAF
GHVRLGGIGQWLADEIEKRTGKEARCTVLGHIQRGGTPSAFDRVLATRFGLHAIDAVHDG
DYGKMVALSGTEIIRVDLSAATDTLKTVPLERYAEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcggagtgctgaccggaggcggtgactgccccggtctgaacgccgtgatccgc
gctgtggtgcgtaagggaatctcggtctacgggtatgagttcgtgggcttccggtcgggc
tggcgcggcccgctggaaggcgacacggtggcgctggacatccaggccgtgcggggcatc
ctgccgcgcggcgggacgatcctgggctcgtcgcggaccaacccgctcaaggtcgagggc
ggcatcgagcggatcaaggacaacctggccgggctcggtgtggatgcgctggtcgccatc
ggcggcgaggacaccctcggcgtcgccaagcatctgcacgaggccggcgtcaacgtggtc
ggggtccccaagaccatcgacaacgacctgaacgccaccgactacaccttcggcttcgac
accgccgtcaacatcgcggtggaggccatcgaccggctgcacaccaccgccgaaagccac
caccgcgccctgatctgcgaggtgatgggccggcacgccgggtggatcgcgctgcacgcc
gggatggccgccggcgccaacgtgatcttgattccggagcggccgttcgacatcgacaag
gtcgtcgagtacgtcgaaagccgcttcaagacccggtatgcgccgatcatcgtggtcgcc
gagggcgcccacccgatcgagggccagatggcggtgcagagcaaggaactggacgccttc
gggcacgtgcggctgggcggcatcggccagtggctggccgacgagatcgaaaagcgcacc
ggcaaggaggcccgctgcaccgtgctgggccacatccagcgcggcggcacgcccagcgcc
ttcgaccgggtgctggccacccgcttcgggctgcacgccatcgacgccgtccacgacggc
gactacggcaagatggtcgccctgtcgggcaccgagatcatccgggtggacctgtcggcc
gccaccgacacgctcaagaccgtcccgctggagcgctacgccgaggcggaggtcttcttc
ggctga

DBGET integrated database retrieval system