KEGG   Thermomonospora curvata: Tcur_3047Help
Entry
Tcur_3047         CDS       T01127                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00010  Glycolysis / Gluconeogenesis
tcu00052  Galactose metabolism
tcu00500  Starch and sucrose metabolism
tcu00520  Amino sugar and nucleotide sugar metabolism
tcu00521  Streptomycin biosynthesis
tcu01100  Metabolic pathways
tcu01110  Biosynthesis of secondary metabolites
tcu01120  Microbial metabolism in diverse environments
tcu01130  Biosynthesis of antibiotics
tcu01200  Carbon metabolism
Module
tcu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcur_3047
   00052 Galactose metabolism
    Tcur_3047
   00500 Starch and sucrose metabolism
    Tcur_3047
   00520 Amino sugar and nucleotide sugar metabolism
    Tcur_3047
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tcur_3047
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tcur_3047
Enzymes [BR:tcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tcur_3047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ACY98589
UniProt: D1A8V1
Position
complement(3533864..3534811)
Genome map
AA seq 315 aa AA seqDB search
MALTIGVDVGGTKVAAGVVDDRGRILEKVRRPTPSTDPRQTAEVIAEVVDLLKGKYPEVE
AVGLGAAGFVDEARATVLFAPNLAWRDEPIKGKVEELVGLPVVVENDANATAWGEFRFGA
GRGERFLVLVALGTGIGGGIIVDGRLYRGRFGIGGEIGHLRMVPDGRRCGCGNRGCWEQY
ASGNALVHEARDLARVAPLMASRLLELGGGSPEGIRGPEVTQAAREGDRAALECFRTVAG
WVGRGLADLTAILDPGAFIIGGGLSDAGDLLLEPVRDAYEAVVTGVGYRPLPDIRIAELG
SDAGLVGAADLARQR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaccatcggcgtggatgtgggaggcaccaaggtcgcggcgggggtggtcgac
gaccgcgggcggattctggagaaggtgcgcaggcccaccccctccaccgacccccggcag
accgccgaggtcatcgccgaggtggtcgatctcctcaagggcaagtaccccgaggtcgag
gcggtcgggctgggcgcggccgggttcgtcgacgaggcccgcgccaccgtgttgttcgcc
cccaacctggcctggcgggacgagccgatcaaaggcaaggtcgaggagctggtcgggctg
ccggtggtggtggagaacgacgccaacgccaccgcctggggcgagttccgcttcggcgcc
ggacgcggcgagcgcttcctggtgctggtggcgctgggcaccggcatcggcggcggcatc
atcgtcgacggccggctgtaccggggacggttcggcatcggcggggagatcggccacctg
cggatggtgcccgacggccgccgctgcggctgcggcaaccgcggctgctgggagcagtac
gccagcggcaacgccctcgtccacgaggcccgcgacctggcccgggtcgccccgctgatg
gcctcccggctgctggagctgggcgggggctccccggagggcatccgcggcccggaggtc
acccaggccgcccgcgagggggaccgggccgcgctggagtgcttccgcaccgtggccggc
tgggtcgggcggggcctggccgacctgaccgcgatcttggacccgggggcgttcatcatc
ggcggcgggctgtcggacgccggggacctgctgctggagccggtccgcgacgcctatgag
gccgtggtcaccggggtcggctaccgtccgctgcccgacatccggatcgccgagctcggc
tccgacgccgggctggtgggcgccgccgacctggcccgccagcgctga

DBGET integrated database retrieval system