KEGG   Thermomonospora curvata: Tcur_3093Help
Entry
Tcur_3093         CDS       T01127                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tcu  Thermomonospora curvata
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcur_3093
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tcur_3093
  Amino acid metabolism
   00310 Lysine degradation
    Tcur_3093
Enzymes [BR:tcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tcur_3093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3582125..3583597
Genome map
AA seq 490 aa AA seqDB search
MPVSVTMPQLGESVTEGTVTRWLKKEGEHVATDEPLLEVSTDKVDTEIPSPASGILTKIS
VAEDETVEVGAELAIISSEEEVSAAAPAAAPQPQPQAQPEPPAAPAQPQSPPPASWPPPA
QSAAPAPPPAPAPAPAPAPQAPPQPAPAPEPQAETPAPAPQPQAPAPAAEAPYVTPLVRK
LAAEHGVDLSQIKGTGVGGRIRKQDVLEAAKAKQAAQQAAPAPAAPQAPAAPQAPAAPAP
AVPSPEALQLRGKTEKMSRIRQTIARRMVESLQVSAQLTTVVEADVTKIARLRERAKDDF
AAREGVKLSFLPFFALAAVEALKVHPKLNAVINSETNEVTYHDVENLGIAVDVPDRGLMV
PVIHNAGQLNLAGLAQRIADLAERTRTNKVSPDELTGGTFTITNTGSRGALFDTPILNQP
QVAMLGTGAVVKRPAVIDDPNLGEVIAVRSMVYLALTYDHRLIDGADAARFLGTVKQRLE
EGNFEAELGL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgccggtctccgtcaccatgccccagctcggcgagagcgtgaccgagggcaccgtcacc
cgctggctgaagaaggagggtgagcacgtcgcgacggacgagccgcttctcgaagtgtcg
accgacaaggtcgacaccgagatcccttcgcctgcctcgggcatcctgaccaagatctcc
gtcgccgaggacgagaccgtggaggtcggcgccgaactggcgatcatctcctctgaggag
gaggtctccgccgccgccccggccgccgcgccgcaaccgcagccgcaggcgcagcccgag
ccgccggccgccccggcccagccgcagtcgccgccgccggcgtcctggccgccgcccgcg
cagtcggccgccccggcgccgcccccggctcccgcaccggccccggctccggctccgcag
gccccgccgcagccggctccggctcccgaaccgcaggccgaaacgcccgccccggcgccg
cagccgcaggcccccgccccggccgcggaggccccttacgtcacgccgctggtgcgcaag
ctggccgccgagcacggcgtggacctcagccagatcaagggcaccggcgtcggcggccgc
atccgcaagcaggacgtgctggaggccgccaaggccaagcaggccgcccagcaggccgcc
ccggctccggcggctccccaggctcccgccgcgccgcaggccccggccgccccggcgccg
gccgttccctcgcccgaggcgctgcagctgcgcggcaagaccgagaagatgtcgcggatc
cggcagaccatcgcccgccggatggtggagtcgctgcaggtgtccgcccagctgaccacc
gtggtcgaggcggacgtcaccaagatcgcgcggctgcgggagcgggccaaggacgacttc
gccgcccgcgagggcgtcaagctgtcgttcctgccgttcttcgcgctggccgcggtcgag
gccctcaaggtccaccccaagctgaacgcggtcatcaacagcgagaccaacgaggtcacc
taccacgacgtggagaacctcggcatcgcggtggacgtgcccgaccgcggcctgatggtg
ccggtcatccacaacgccgggcagctcaacctggccggcctggcccagcgcatcgccgac
ctggccgagcgcacccgcaccaacaaggtgagcccggacgagctgaccggcggcacgttc
accatcaccaacaccggcagccgcggcgcgctgttcgacaccccgatcctcaaccagccg
caggtcgccatgctcggcaccggcgcggtcgtcaagcgcccggcggtcatcgacgacccg
aacctcggcgaggtcatcgcggtccgctcgatggtctacctggcgctgacctacgaccac
cggctgatcgacggcgccgacgccgcccgtttcctgggcaccgtcaagcagcgcctggaa
gagggcaacttcgaggccgagctcggtctgtga

DBGET integrated database retrieval system