KEGG   Thermomonospora curvata: Tcur_3093Help
Entry
Tcur_3093         CDS       T01127                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tcu  Thermomonospora curvata
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcur_3093
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tcur_3093
  Amino acid metabolism
   00310 Lysine degradation
    Tcur_3093
Enzymes [BR:tcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tcur_3093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3582125..3583597
Genome map
AA seq 490 aa AA seqDB search
MPVSVTMPQLGESVTEGTVTRWLKKEGEHVATDEPLLEVSTDKVDTEIPSPASGILTKIS
VAEDETVEVGAELAIISSEEEVSAAAPAAAPQPQPQAQPEPPAAPAQPQSPPPASWPPPA
QSAAPAPPPAPAPAPAPAPQAPPQPAPAPEPQAETPAPAPQPQAPAPAAEAPYVTPLVRK
LAAEHGVDLSQIKGTGVGGRIRKQDVLEAAKAKQAAQQAAPAPAAPQAPAAPQAPAAPAP
AVPSPEALQLRGKTEKMSRIRQTIARRMVESLQVSAQLTTVVEADVTKIARLRERAKDDF
AAREGVKLSFLPFFALAAVEALKVHPKLNAVINSETNEVTYHDVENLGIAVDVPDRGLMV
PVIHNAGQLNLAGLAQRIADLAERTRTNKVSPDELTGGTFTITNTGSRGALFDTPILNQP
QVAMLGTGAVVKRPAVIDDPNLGEVIAVRSMVYLALTYDHRLIDGADAARFLGTVKQRLE
EGNFEAELGL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgccggtctccgtcaccatgccccagctcggcgagagcgtgaccgagggcaccgtcacc
cgctggctgaagaaggagggtgagcacgtcgcgacggacgagccgcttctcgaagtgtcg
accgacaaggtcgacaccgagatcccttcgcctgcctcgggcatcctgaccaagatctcc
gtcgccgaggacgagaccgtggaggtcggcgccgaactggcgatcatctcctctgaggag
gaggtctccgccgccgccccggccgccgcgccgcaaccgcagccgcaggcgcagcccgag
ccgccggccgccccggcccagccgcagtcgccgccgccggcgtcctggccgccgcccgcg
cagtcggccgccccggcgccgcccccggctcccgcaccggccccggctccggctccgcag
gccccgccgcagccggctccggctcccgaaccgcaggccgaaacgcccgccccggcgccg
cagccgcaggcccccgccccggccgcggaggccccttacgtcacgccgctggtgcgcaag
ctggccgccgagcacggcgtggacctcagccagatcaagggcaccggcgtcggcggccgc
atccgcaagcaggacgtgctggaggccgccaaggccaagcaggccgcccagcaggccgcc
ccggctccggcggctccccaggctcccgccgcgccgcaggccccggccgccccggcgccg
gccgttccctcgcccgaggcgctgcagctgcgcggcaagaccgagaagatgtcgcggatc
cggcagaccatcgcccgccggatggtggagtcgctgcaggtgtccgcccagctgaccacc
gtggtcgaggcggacgtcaccaagatcgcgcggctgcgggagcgggccaaggacgacttc
gccgcccgcgagggcgtcaagctgtcgttcctgccgttcttcgcgctggccgcggtcgag
gccctcaaggtccaccccaagctgaacgcggtcatcaacagcgagaccaacgaggtcacc
taccacgacgtggagaacctcggcatcgcggtggacgtgcccgaccgcggcctgatggtg
ccggtcatccacaacgccgggcagctcaacctggccggcctggcccagcgcatcgccgac
ctggccgagcgcacccgcaccaacaaggtgagcccggacgagctgaccggcggcacgttc
accatcaccaacaccggcagccgcggcgcgctgttcgacaccccgatcctcaaccagccg
caggtcgccatgctcggcaccggcgcggtcgtcaagcgcccggcggtcatcgacgacccg
aacctcggcgaggtcatcgcggtccgctcgatggtctacctggcgctgacctacgaccac
cggctgatcgacggcgccgacgccgcccgtttcctgggcaccgtcaagcagcgcctggaa
gagggcaacttcgaggccgagctcggtctgtga

DBGET integrated database retrieval system