KEGG   Thermomonospora curvata: Tcur_3093Help
Entry
Tcur_3093         CDS       T01127                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00020  Citrate cycle (TCA cycle)
tcu00310  Lysine degradation
tcu01100  Metabolic pathways
tcu01110  Biosynthesis of secondary metabolites
tcu01120  Microbial metabolism in diverse environments
tcu01130  Biosynthesis of antibiotics
tcu01200  Carbon metabolism
Module
tcu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tcu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tcur_3093
  Amino acid metabolism
   00310 Lysine degradation
    Tcur_3093
Enzymes [BR:tcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tcur_3093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACY98635
UniProt: D1A8Z7
Position
3582125..3583597
Genome map
AA seq 490 aa AA seqDB search
MPVSVTMPQLGESVTEGTVTRWLKKEGEHVATDEPLLEVSTDKVDTEIPSPASGILTKIS
VAEDETVEVGAELAIISSEEEVSAAAPAAAPQPQPQAQPEPPAAPAQPQSPPPASWPPPA
QSAAPAPPPAPAPAPAPAPQAPPQPAPAPEPQAETPAPAPQPQAPAPAAEAPYVTPLVRK
LAAEHGVDLSQIKGTGVGGRIRKQDVLEAAKAKQAAQQAAPAPAAPQAPAAPQAPAAPAP
AVPSPEALQLRGKTEKMSRIRQTIARRMVESLQVSAQLTTVVEADVTKIARLRERAKDDF
AAREGVKLSFLPFFALAAVEALKVHPKLNAVINSETNEVTYHDVENLGIAVDVPDRGLMV
PVIHNAGQLNLAGLAQRIADLAERTRTNKVSPDELTGGTFTITNTGSRGALFDTPILNQP
QVAMLGTGAVVKRPAVIDDPNLGEVIAVRSMVYLALTYDHRLIDGADAARFLGTVKQRLE
EGNFEAELGL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgccggtctccgtcaccatgccccagctcggcgagagcgtgaccgagggcaccgtcacc
cgctggctgaagaaggagggtgagcacgtcgcgacggacgagccgcttctcgaagtgtcg
accgacaaggtcgacaccgagatcccttcgcctgcctcgggcatcctgaccaagatctcc
gtcgccgaggacgagaccgtggaggtcggcgccgaactggcgatcatctcctctgaggag
gaggtctccgccgccgccccggccgccgcgccgcaaccgcagccgcaggcgcagcccgag
ccgccggccgccccggcccagccgcagtcgccgccgccggcgtcctggccgccgcccgcg
cagtcggccgccccggcgccgcccccggctcccgcaccggccccggctccggctccgcag
gccccgccgcagccggctccggctcccgaaccgcaggccgaaacgcccgccccggcgccg
cagccgcaggcccccgccccggccgcggaggccccttacgtcacgccgctggtgcgcaag
ctggccgccgagcacggcgtggacctcagccagatcaagggcaccggcgtcggcggccgc
atccgcaagcaggacgtgctggaggccgccaaggccaagcaggccgcccagcaggccgcc
ccggctccggcggctccccaggctcccgccgcgccgcaggccccggccgccccggcgccg
gccgttccctcgcccgaggcgctgcagctgcgcggcaagaccgagaagatgtcgcggatc
cggcagaccatcgcccgccggatggtggagtcgctgcaggtgtccgcccagctgaccacc
gtggtcgaggcggacgtcaccaagatcgcgcggctgcgggagcgggccaaggacgacttc
gccgcccgcgagggcgtcaagctgtcgttcctgccgttcttcgcgctggccgcggtcgag
gccctcaaggtccaccccaagctgaacgcggtcatcaacagcgagaccaacgaggtcacc
taccacgacgtggagaacctcggcatcgcggtggacgtgcccgaccgcggcctgatggtg
ccggtcatccacaacgccgggcagctcaacctggccggcctggcccagcgcatcgccgac
ctggccgagcgcacccgcaccaacaaggtgagcccggacgagctgaccggcggcacgttc
accatcaccaacaccggcagccgcggcgcgctgttcgacaccccgatcctcaaccagccg
caggtcgccatgctcggcaccggcgcggtcgtcaagcgcccggcggtcatcgacgacccg
aacctcggcgaggtcatcgcggtccgctcgatggtctacctggcgctgacctacgaccac
cggctgatcgacggcgccgacgccgcccgtttcctgggcaccgtcaagcagcgcctggaa
gagggcaacttcgaggccgagctcggtctgtga

DBGET integrated database retrieval system