KEGG   Thermomonospora curvata: Tcur_3270Help
Entry
Tcur_3270         CDS       T01127                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tcu  Thermomonospora curvata
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcur_3270
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tcur_3270
   00630 Glyoxylate and dicarboxylate metabolism
    Tcur_3270
Enzymes [BR:tcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Tcur_3270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3776343..3777950
Genome map
AA seq 535 aa AA seqDB search
MTAPDGVEVTGPLHERYDEILTPEALSFLATLQREFGARRKELLAARAEREKQLAAGGTL
DFLPETAHIRADDSWRVAEPAPGLVDRRVEITGPTDRKMTINALNSGAKVWLADFEDANT
PLWENMIQGQINLRDALDRTIDFTDPKTGKSYALRPDEELATIVVRPRGWHMEEKHVLVD
GEPMSGSLFDFGLYFFHCARRQLAKGKGPYFYLPKMESHLEARLWNDAFNLAQDELEIPR
GTIRATVLIETITAAFEMEEILYELRDHSAGLNAGRWDYLFSVIKKFRSRGAEFVLPERN
AITMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRKDPEVNKVAFEKVRADKTREAN
DGFDGSWVAHPDLVPVCREVFDGVLGDKPNQRDRLREDVKVSAADLLAFDKTPGEITEAG
LRNNIDVALRYLATWLGGNGAVAIHNLMEDAATAEISRSQVWQWINNGVTLKEGQKVTKE
LVEKIMDEELAGIRAELGQAYDEPRYNQAVALFKEVTLADEYAEFLTLPAYERMP
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccgacggtgtggaggtcaccggtcccctccacgagcgctacgacgagatc
ctcacgcccgaggcgctgtccttcctggccacgctgcagcgcgagttcggcgcgcggcgc
aaggagctgctggccgcccgcgccgagcgggaaaagcagctggccgccgggggcacgctg
gacttcctgccggagacggcgcacatccgcgccgacgacagctggcgggtggccgagccg
gcgcccggcctggtggaccggcgggtggagatcaccggccccaccgaccggaagatgacg
atcaacgcgctgaactccggcgccaaggtgtggctggccgacttcgaggacgccaacacc
ccgctgtgggagaacatgatccagggccagatcaacctgcgggacgccctggaccgcacc
atcgacttcaccgaccccaagaccggcaagagctacgcgctgcggccggacgaggagctg
gccaccatcgtggtccgcccccgcggctggcacatggaggaaaagcacgtcctggtggac
ggggagccgatgagcggctcgctgttcgacttcgggctgtacttcttccactgcgcccgc
cgccagctcgccaagggcaagggcccctacttctacctgcccaagatggagagccacctg
gaggcgcggctgtggaacgacgccttcaacctggcccaggacgagctggagatcccgcgc
ggcaccatccgcgccaccgtgctgatcgagaccatcacggcggcgttcgagatggaggag
atcctgtatgagctgcgcgaccactccgccgggctgaacgccggccgctgggactacctg
ttctcggtgatcaagaagttccgctcccggggcgcggagttcgtgctgccggagcgcaac
gccatcaccatgaccgccccgttcatgcgggcctacaccgagctgctggtgcgcacctgc
cacaagcgcggcgcccacgccatcggcggcatggccgccttcatcccctcccgcaaggac
cccgaggtcaacaaggtcgccttcgagaaggtgcgggccgacaagacccgggaggccaac
gacgggttcgacggctcgtgggtggcccaccccgacctggtgccggtgtgccgggaggtc
ttcgacggcgtgctgggcgacaagcccaaccagcgcgaccggctgcgcgaggacgtcaag
gtctccgccgccgacctgctggccttcgacaagacccccggtgagatcaccgaggcgggc
ctgcgcaacaacatcgacgtggcgctgcggtacctggccacctggctgggcggcaacggc
gcggtggccatccacaacctgatggaggacgccgccaccgccgagatctcccgctcccag
gtctggcagtggatcaacaacggggtgaccctcaaggagggccagaaggtcaccaaggag
ctcgtcgagaagatcatggacgaggagctggccggcatccgcgccgagctgggccaggcc
tacgacgagccgcgctacaaccaggccgtcgccctgttcaaggaggtcacgctggccgac
gagtacgccgagttcctcaccctgccggcctacgagcgcatgccctag

DBGET integrated database retrieval system