KEGG   Thermomonospora curvata: Tcur_3270Help
Entry
Tcur_3270         CDS       T01127                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tcu  Thermomonospora curvata
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcur_3270
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tcur_3270
   00630 Glyoxylate and dicarboxylate metabolism
    Tcur_3270
Enzymes [BR:tcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Tcur_3270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3776343..3777950
Genome map
AA seq 535 aa AA seqDB search
MTAPDGVEVTGPLHERYDEILTPEALSFLATLQREFGARRKELLAARAEREKQLAAGGTL
DFLPETAHIRADDSWRVAEPAPGLVDRRVEITGPTDRKMTINALNSGAKVWLADFEDANT
PLWENMIQGQINLRDALDRTIDFTDPKTGKSYALRPDEELATIVVRPRGWHMEEKHVLVD
GEPMSGSLFDFGLYFFHCARRQLAKGKGPYFYLPKMESHLEARLWNDAFNLAQDELEIPR
GTIRATVLIETITAAFEMEEILYELRDHSAGLNAGRWDYLFSVIKKFRSRGAEFVLPERN
AITMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRKDPEVNKVAFEKVRADKTREAN
DGFDGSWVAHPDLVPVCREVFDGVLGDKPNQRDRLREDVKVSAADLLAFDKTPGEITEAG
LRNNIDVALRYLATWLGGNGAVAIHNLMEDAATAEISRSQVWQWINNGVTLKEGQKVTKE
LVEKIMDEELAGIRAELGQAYDEPRYNQAVALFKEVTLADEYAEFLTLPAYERMP
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccgacggtgtggaggtcaccggtcccctccacgagcgctacgacgagatc
ctcacgcccgaggcgctgtccttcctggccacgctgcagcgcgagttcggcgcgcggcgc
aaggagctgctggccgcccgcgccgagcgggaaaagcagctggccgccgggggcacgctg
gacttcctgccggagacggcgcacatccgcgccgacgacagctggcgggtggccgagccg
gcgcccggcctggtggaccggcgggtggagatcaccggccccaccgaccggaagatgacg
atcaacgcgctgaactccggcgccaaggtgtggctggccgacttcgaggacgccaacacc
ccgctgtgggagaacatgatccagggccagatcaacctgcgggacgccctggaccgcacc
atcgacttcaccgaccccaagaccggcaagagctacgcgctgcggccggacgaggagctg
gccaccatcgtggtccgcccccgcggctggcacatggaggaaaagcacgtcctggtggac
ggggagccgatgagcggctcgctgttcgacttcgggctgtacttcttccactgcgcccgc
cgccagctcgccaagggcaagggcccctacttctacctgcccaagatggagagccacctg
gaggcgcggctgtggaacgacgccttcaacctggcccaggacgagctggagatcccgcgc
ggcaccatccgcgccaccgtgctgatcgagaccatcacggcggcgttcgagatggaggag
atcctgtatgagctgcgcgaccactccgccgggctgaacgccggccgctgggactacctg
ttctcggtgatcaagaagttccgctcccggggcgcggagttcgtgctgccggagcgcaac
gccatcaccatgaccgccccgttcatgcgggcctacaccgagctgctggtgcgcacctgc
cacaagcgcggcgcccacgccatcggcggcatggccgccttcatcccctcccgcaaggac
cccgaggtcaacaaggtcgccttcgagaaggtgcgggccgacaagacccgggaggccaac
gacgggttcgacggctcgtgggtggcccaccccgacctggtgccggtgtgccgggaggtc
ttcgacggcgtgctgggcgacaagcccaaccagcgcgaccggctgcgcgaggacgtcaag
gtctccgccgccgacctgctggccttcgacaagacccccggtgagatcaccgaggcgggc
ctgcgcaacaacatcgacgtggcgctgcggtacctggccacctggctgggcggcaacggc
gcggtggccatccacaacctgatggaggacgccgccaccgccgagatctcccgctcccag
gtctggcagtggatcaacaacggggtgaccctcaaggagggccagaaggtcaccaaggag
ctcgtcgagaagatcatggacgaggagctggccggcatccgcgccgagctgggccaggcc
tacgacgagccgcgctacaaccaggccgtcgccctgttcaaggaggtcacgctggccgac
gagtacgccgagttcctcaccctgccggcctacgagcgcatgccctag

DBGET integrated database retrieval system