KEGG   Thermomonospora curvata: Tcur_3270Help
Entry
Tcur_3270         CDS       T01127                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00620  Pyruvate metabolism
tcu00630  Glyoxylate and dicarboxylate metabolism
tcu01100  Metabolic pathways
tcu01110  Biosynthesis of secondary metabolites
tcu01120  Microbial metabolism in diverse environments
tcu01200  Carbon metabolism
Module
tcu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tcur_3270
   00630 Glyoxylate and dicarboxylate metabolism
    Tcur_3270
Enzymes [BR:tcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Tcur_3270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACY98809
UniProt: D1AA96
Position
3776343..3777950
Genome map
AA seq 535 aa AA seqDB search
MTAPDGVEVTGPLHERYDEILTPEALSFLATLQREFGARRKELLAARAEREKQLAAGGTL
DFLPETAHIRADDSWRVAEPAPGLVDRRVEITGPTDRKMTINALNSGAKVWLADFEDANT
PLWENMIQGQINLRDALDRTIDFTDPKTGKSYALRPDEELATIVVRPRGWHMEEKHVLVD
GEPMSGSLFDFGLYFFHCARRQLAKGKGPYFYLPKMESHLEARLWNDAFNLAQDELEIPR
GTIRATVLIETITAAFEMEEILYELRDHSAGLNAGRWDYLFSVIKKFRSRGAEFVLPERN
AITMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRKDPEVNKVAFEKVRADKTREAN
DGFDGSWVAHPDLVPVCREVFDGVLGDKPNQRDRLREDVKVSAADLLAFDKTPGEITEAG
LRNNIDVALRYLATWLGGNGAVAIHNLMEDAATAEISRSQVWQWINNGVTLKEGQKVTKE
LVEKIMDEELAGIRAELGQAYDEPRYNQAVALFKEVTLADEYAEFLTLPAYERMP
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccgacggtgtggaggtcaccggtcccctccacgagcgctacgacgagatc
ctcacgcccgaggcgctgtccttcctggccacgctgcagcgcgagttcggcgcgcggcgc
aaggagctgctggccgcccgcgccgagcgggaaaagcagctggccgccgggggcacgctg
gacttcctgccggagacggcgcacatccgcgccgacgacagctggcgggtggccgagccg
gcgcccggcctggtggaccggcgggtggagatcaccggccccaccgaccggaagatgacg
atcaacgcgctgaactccggcgccaaggtgtggctggccgacttcgaggacgccaacacc
ccgctgtgggagaacatgatccagggccagatcaacctgcgggacgccctggaccgcacc
atcgacttcaccgaccccaagaccggcaagagctacgcgctgcggccggacgaggagctg
gccaccatcgtggtccgcccccgcggctggcacatggaggaaaagcacgtcctggtggac
ggggagccgatgagcggctcgctgttcgacttcgggctgtacttcttccactgcgcccgc
cgccagctcgccaagggcaagggcccctacttctacctgcccaagatggagagccacctg
gaggcgcggctgtggaacgacgccttcaacctggcccaggacgagctggagatcccgcgc
ggcaccatccgcgccaccgtgctgatcgagaccatcacggcggcgttcgagatggaggag
atcctgtatgagctgcgcgaccactccgccgggctgaacgccggccgctgggactacctg
ttctcggtgatcaagaagttccgctcccggggcgcggagttcgtgctgccggagcgcaac
gccatcaccatgaccgccccgttcatgcgggcctacaccgagctgctggtgcgcacctgc
cacaagcgcggcgcccacgccatcggcggcatggccgccttcatcccctcccgcaaggac
cccgaggtcaacaaggtcgccttcgagaaggtgcgggccgacaagacccgggaggccaac
gacgggttcgacggctcgtgggtggcccaccccgacctggtgccggtgtgccgggaggtc
ttcgacggcgtgctgggcgacaagcccaaccagcgcgaccggctgcgcgaggacgtcaag
gtctccgccgccgacctgctggccttcgacaagacccccggtgagatcaccgaggcgggc
ctgcgcaacaacatcgacgtggcgctgcggtacctggccacctggctgggcggcaacggc
gcggtggccatccacaacctgatggaggacgccgccaccgccgagatctcccgctcccag
gtctggcagtggatcaacaacggggtgaccctcaaggagggccagaaggtcaccaaggag
ctcgtcgagaagatcatggacgaggagctggccggcatccgcgccgagctgggccaggcc
tacgacgagccgcgctacaaccaggccgtcgccctgttcaaggaggtcacgctggccgac
gagtacgccgagttcctcaccctgccggcctacgagcgcatgccctag

DBGET integrated database retrieval system