KEGG   Thermomonospora curvata: Tcur_3471Help
Entry
Tcur_3471         CDS       T01127                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00360  Phenylalanine metabolism
tcu00362  Benzoate degradation
tcu00620  Pyruvate metabolism
tcu00621  Dioxin degradation
tcu00622  Xylene degradation
tcu00650  Butanoate metabolism
tcu01100  Metabolic pathways
tcu01120  Microbial metabolism in diverse environments
tcu01220  Degradation of aromatic compounds
Module
tcu_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tcur_3471
   00650 Butanoate metabolism
    Tcur_3471
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Tcur_3471
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tcur_3471
   00622 Xylene degradation
    Tcur_3471
   00621 Dioxin degradation
    Tcur_3471
Enzymes [BR:tcu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Tcur_3471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ACY99009
UniProt: D1AB66
Position
complement(3986535..3987431)
Genome map
AA seq 298 aa AA seqDB search
MAATAAIVGPGNIGTDLLYKLLRSEHIEPRYMVGIDPDSEGLKRAAKLGLETSHEGIDWL
LSRPEKPDLVFEATSAYVHRAAAPRYKEAGIRAIDLTPAAIGPGVVPPANLREHLDADNV
NLVTCGGQATIPMVYAVSRVVPVEYAEIVASVASVSAGPGTRANIDEFTKTTARAIETIG
GARRGKAIIILNPAEPPVIMRDTVFCSIPPDADRDKIAESILEVRAQVAEYVPGYRLRAE
PQFDDPSPVSGGMARVAIFLEVEGAGDFLPPYAGNLDIMTAAATKVGEVLAQEITGSD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaccgccgcgatcgtcgggccgggcaacatcggcaccgacctgctgtacaag
ctgctgcgcagcgagcacatcgaaccgcgctacatggtggggatcgaccccgacagcgag
gggctgaaacgggccgccaagctggggttggagaccagccacgagggcatcgactggctg
ctgtcccgtcccgaaaagcccgacctggtgttcgaggcgacctcggcctatgtgcaccgg
gccgccgcgccccgctacaaggaggccggcatccgggccatcgacttgacccccgccgcg
atcgggcccggcgtggtgccgccggccaatctgcgcgagcacctggacgccgacaacgtc
aatttggtcacctgcggcggccaggccaccatccccatggtgtacgcggtctcccgggtg
gtgccggtggagtacgccgagatcgtcgcctcggtggcgtcggtgtcggccggcccgggc
acccgcgccaacatcgacgagttcaccaagaccaccgcccgcgccatcgagaccatcggc
ggcgcccgccgcggcaaggccatcatcatcctcaacccggccgaaccgccggtgatcatg
cgggacacggtgttctgctcgatcccgcccgacgccgaccgcgacaagatcgccgagtcc
atcctggaggtgcgggcccaggtcgccgagtacgtgcccggctaccggctgcgggccgag
ccccagttcgacgaccccagccccgtcagcggcgggatggcccgcgtggcgatcttcctg
gaggtggagggcgcgggcgacttcctgcccccctacgccggcaacctcgacatcatgacc
gccgccgccaccaaggtcggtgaggtcctcgcccaggagatcaccgggagcgactga

DBGET integrated database retrieval system