KEGG   Thermomonospora curvata: Tcur_3471Help
Entry
Tcur_3471         CDS       T01127                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
tcu  Thermomonospora curvata
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tcur_3471
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tcur_3471
   00650 Butanoate metabolism
    Tcur_3471
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Tcur_3471
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tcur_3471
   00622 Xylene degradation
    Tcur_3471
   00621 Dioxin degradation
    Tcur_3471
Enzymes [BR:tcu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Tcur_3471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3986535..3987431)
Genome map
AA seq 298 aa AA seqDB search
MAATAAIVGPGNIGTDLLYKLLRSEHIEPRYMVGIDPDSEGLKRAAKLGLETSHEGIDWL
LSRPEKPDLVFEATSAYVHRAAAPRYKEAGIRAIDLTPAAIGPGVVPPANLREHLDADNV
NLVTCGGQATIPMVYAVSRVVPVEYAEIVASVASVSAGPGTRANIDEFTKTTARAIETIG
GARRGKAIIILNPAEPPVIMRDTVFCSIPPDADRDKIAESILEVRAQVAEYVPGYRLRAE
PQFDDPSPVSGGMARVAIFLEVEGAGDFLPPYAGNLDIMTAAATKVGEVLAQEITGSD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaccgccgcgatcgtcgggccgggcaacatcggcaccgacctgctgtacaag
ctgctgcgcagcgagcacatcgaaccgcgctacatggtggggatcgaccccgacagcgag
gggctgaaacgggccgccaagctggggttggagaccagccacgagggcatcgactggctg
ctgtcccgtcccgaaaagcccgacctggtgttcgaggcgacctcggcctatgtgcaccgg
gccgccgcgccccgctacaaggaggccggcatccgggccatcgacttgacccccgccgcg
atcgggcccggcgtggtgccgccggccaatctgcgcgagcacctggacgccgacaacgtc
aatttggtcacctgcggcggccaggccaccatccccatggtgtacgcggtctcccgggtg
gtgccggtggagtacgccgagatcgtcgcctcggtggcgtcggtgtcggccggcccgggc
acccgcgccaacatcgacgagttcaccaagaccaccgcccgcgccatcgagaccatcggc
ggcgcccgccgcggcaaggccatcatcatcctcaacccggccgaaccgccggtgatcatg
cgggacacggtgttctgctcgatcccgcccgacgccgaccgcgacaagatcgccgagtcc
atcctggaggtgcgggcccaggtcgccgagtacgtgcccggctaccggctgcgggccgag
ccccagttcgacgaccccagccccgtcagcggcgggatggcccgcgtggcgatcttcctg
gaggtggagggcgcgggcgacttcctgcccccctacgccggcaacctcgacatcatgacc
gccgccgccaccaaggtcggtgaggtcctcgcccaggagatcaccgggagcgactga

DBGET integrated database retrieval system