KEGG   Thermomonospora curvata: Tcur_3515Help
Entry
Tcur_3515         CDS       T01127                                 

Definition
fumarate reductase/succinate dehydrogenase flavoprotein domain-containing protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
tcu  Thermomonospora curvata
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Tcur_3515
Enzymes [BR:tcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     Tcur_3515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4032707..4034185)
Genome map
AA seq 492 aa AA seqDB search
MPMSSVEPIGVREVGAFDHECDVLVVGFGCAGAAAAFEAASAGVSVLVLEKAGGPGGASA
MSGGELYLGGGTEIQKACGFDDDPDNMYAYLEAALGPHVDAAKLRLYCDESVEHFEWFRA
RGLTFNPSLFDAPTWMPYTEDGLMWLGENAWPYNTIARPVPRGHRPAAKGFGGRLLMEKL
TAAATAAGAVTHADTAATNLVLDDDGRVAGVVARKYGERVTYRARKAVILTTGGFVDNDE
MLAHHAPVLLGHDKVSDGNSDGSGIRMATAIGAATRRMSVVEAALTALPAVVVRGMLVDA
LGRRFINEDVYPGLYSHRALLHQPAPYWSIIDEEGFESIPESERWGVRPKYAAETAAELG
EELGMPPGALETTIEIYNRHAEKGEDPYFHKDPKWLRPLRGPLAAIDPAEGFFPGERDRG
SKGTGVNGFTLGGLHTNVDGQVLNNSGEPIAGLYAAGRASSGIHGEGYVSGTSLGDGTFF
GRRAGRAAAGED
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgagctctgtggaaccgatcggcgtccgcgaagtcggcgccttcgaccacgag
tgcgacgtgctggtggtcgggttcggctgcgcgggcgccgcggccgccttcgaggcggcc
agtgcgggcgtgagcgtgctggtgctggagaaggccggcggccccggcggggcgtcggcc
atgtccggcggggagctgtacctgggcggcggcaccgagatccagaaggcgtgcgggttc
gacgacgaccccgacaacatgtacgcctacctggaggcggcgctcggcccgcacgtcgat
gccgccaagctgcggctgtactgcgatgagagcgtggagcacttcgagtggttccgcgcc
cgcggcctgacgttcaaccccagcctgttcgacgcccccacctggatgccctacaccgag
gacgggctgatgtggctgggggagaacgcctggccctacaacaccatcgcccgtccagtc
ccgcgcggccaccgcccggcggccaagggcttcggcggccggctgctgatggagaagctg
acggccgccgccaccgccgccggcgccgtcacccacgccgacaccgccgccaccaatttg
gtgctggacgacgacggccgggtggccggggtggtggcgcgcaagtacggcgagcgggtc
acctaccgggcgcgcaaggcggtcatcctcaccaccggcggtttcgtcgacaacgacgag
atgctcgcccaccacgccccggtgctgctgggccacgacaaggtcagcgacggcaacagc
gacggctccggcatccgcatggccaccgccatcggcgccgccacccgccgcatgagcgtg
gtggaggccgcgctgaccgcgctgccggccgtggtggtccgcggcatgctggtggacgcc
ctcggccgccggttcatcaacgaggacgtctacccgggcctctacagccaccgagcgctg
ctgcaccagcccgccccctactggtcgatcatcgacgaggagggcttcgaatccatcccc
gagtccgagcggtggggggtgcggcccaagtacgccgccgagaccgccgccgagctcggc
gaggaactgggcatgccgcccggcgcgctggagaccaccatcgagatctacaaccggcac
gccgaaaagggcgaggacccctacttccacaaggaccccaagtggctgcgcccgctgcgg
ggcccgctggcggcgatcgacccggccgagggcttcttccccggtgagcgggaccgcggc
agcaagggcaccggggtcaacgggttcaccctcggcgggctgcacaccaacgtggacggc
caggtcctcaacaactccggcgagcccatcgccggcttgtacgcggcgggccgggcctcc
tccggcatccacggcgagggctatgtcagcggcacgtcgctgggcgacggcacgttcttc
ggccgccgcgccggacgcgccgcagcgggagaggactga

DBGET integrated database retrieval system