KEGG   Thermomonospora curvata: Tcur_3603Help
Entry
Tcur_3603         CDS       T01127                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tcu  Thermomonospora curvata
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tcu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4144213..4146423
Genome map
AA seq 736 aa AA seqDB search
MTGVTHEDLDRLVGGHHHDPHSILGAHPGPDGVVIRALRPLAEQVEAILPDGTRHRLHHV
HEGVFEVVLEAHRAVPDYRLAVRYAGGPELIQDDPYRHLPTVGELDLHLFGEGRHEELWR
ALGARVRSFPSQFGETRGVSFTVWAPNARGVRVIGDFNHWDGRAHPMRSLGASGVWELFV
PGLGNGTTYKFEVLGADGQWRGKADPMARWTEQPPATASRVFESSYEWGDGAWMEQRASR
DWLHEPMSIYEVHLGSWRKGLGYRELAEELTAYVQEMGFTHVEFLPVAEHPYGPSWGYQV
TSYYAPTSRFGTPDDFRHLVDRLHQAGIGVLIDWVPAHFPRDEWALARFDGTALYEHDDP
RKGEHPDWGTLVFNYGRAEVRNFLVANACYWLEEFHIDGLRVDAVASMLYLDYSRKDGEW
TPNVYGGRENLEAISFLQETNATVYRRYPGIITVAEESTAWPGVTRPTHLGGLGFGFKWN
MGWMHDTLTYLQHDPVFRHYHHNEITFSLIYAFSENYVLPLSHDEVVHLKGSLLAKMPGD
TWKKFAGLRALFAYMWAHPGKQLLFMGGEFAQGGEWAEERPLDWWLLDNAAEGAAHLGVQ
KLVRDLNRVYRSCPALYTIDNEPGGFHWIDAGDAGRNTLSFLRYGSDGSVLACVVNFSGS
PHENYRIGLPQAGGWREIVNTDAYEYGGSGVGNMGHVTAVDEPSHAQPASAVIRVPPLGA
LWLVPEESARPRPTAR
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgacaggggtgacgcacgaggacctcgaccggctcgtcggcgggcaccaccacgatccg
cactcgatcctgggagcccatcccggtcccgacggggtcgtcatccgggcgctgcggccg
ctggccgagcaggtggaggcgatcttgccggacggcacccgtcaccggctgcaccacgtc
cacgaaggggtgttcgaggtcgtcctcgaggcgcaccgggccgttcccgactaccggctg
gcggtgcgttatgccggcgggcccgagctgatccaggacgacccttaccggcacctgccc
accgtgggggaactggacctgcacctgttcggcgaggggcgccatgaggagctgtggcgg
gcgctgggcgcccgggtgcgttccttcccctcgcagttcggcgagacccgcggggtgtcc
ttcacggtgtgggcgcccaacgcccgcggggtgcgggtgatcggcgacttcaaccactgg
gacgggcgggcccacccgatgcggtcgctgggcgccagcggcgtgtgggagctgttcgtt
cccggcctgggcaacggcaccacctataagttcgaggtgctcggcgcggacggccaatgg
cgcggcaaggccgacccgatggcccggtggaccgagcagccgccggccaccgcgtcccgg
gtgttcgagtcctcctatgagtggggcgacggcgcgtggatggagcagcgcgcctcccgc
gactggctgcacgagccgatgagcatctacgaagtccacctggggtcctggcgcaaaggg
ctcggctaccgggagctggccgaggagctcaccgcctacgtgcaggagatgggcttcacc
cacgtggagttcctgccggtcgccgagcacccctacggcccgtcctggggctaccaggtg
acctcctactacgctcccacgtcccggttcggcacccccgacgacttccgccacctggtc
gaccggctgcaccaggccggcatcggcgtgctgatcgactgggtgcccgcgcacttcccc
agggacgagtgggcgctggcccgcttcgacggcaccgccctgtacgagcacgacgacccg
cgcaagggcgagcatcccgactggggcacgctggtgttcaactacggccgcgccgaggtg
cgcaacttcctggtcgccaacgcctgctactggctggaggagttccacatcgacgggctg
cgcgtggacgccgtcgcctccatgctgtacctggactactcccgcaaggacggggagtgg
acccccaacgtctacggcggccgggagaacctggaggccatctccttcctgcaggagacc
aacgccaccgtctaccggcgctacccgggcatcatcaccgtcgccgaggagtccaccgcc
tggcccggagtcacccgccccacccatctgggcgggctgggcttcggcttcaagtggaac
atgggctggatgcacgacaccctgacctacctgcagcacgacccggtgttccggcactac
caccacaacgagatcaccttctcgctgatctacgccttctccgagaactacgtgctgccg
ctgtcccacgatgaggtcgtgcacctgaagggctcgctgctggccaagatgcccggcgac
acctggaagaagttcgccggcctgcgcgccttgttcgcctacatgtgggcgcacccgggc
aagcagctgctgttcatgggcggggagttcgcccagggcggcgagtgggccgaagaacgc
cccctggactggtggctgctggacaacgccgccgagggcgccgcgcacctgggcgtccaa
aagctcgtgcgcgacctcaaccgcgtctaccgctcctgcccggccctgtacaccatcgac
aacgagcccggcggcttccactggatcgacgccggcgacgccggccgcaacaccctgtcg
ttcctgcgctacggctccgacggctcggtgctggcctgcgtggtcaacttctccggcagc
ccccatgagaactaccgcatcggcctgccccaggccggcggctggcgcgagatcgtcaac
accgacgcctacgagtacggcggcagcggcgtgggcaacatgggccatgtgaccgccgtc
gacgagccctcccacgcccagccggcctccgccgtcatccgcgtccccccgctgggcgcc
ctctggctcgtccccgaagagtccgcccgcccccgcccgaccgcgcgctag

DBGET integrated database retrieval system