KEGG   Thermomonospora curvata: Tcur_3877Help
Entry
Tcur_3877         CDS       T01127                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tcu  Thermomonospora curvata
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Tcur_3877
Enzymes [BR:tcu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Tcur_3877
    3.5.1.-  
     Tcur_3877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4421838..4422416
Genome map
AA seq 192 aa AA seqDB search
MGRALIIVDVQNDFCEGGSLAVAGGADVASAISRYLQEHGDAYDHVVATRDFHLDPGDHF
ADEPDYVDSWPPHCVIGTPGADFHPNLSLAPIEAVFSKGHHSAAYSGFEGAADDGTSLAD
WLRARRVDQVDVVGIATDHCVRATALDAARAGFRTRVLLELTAGVAEATTERALEQLRAE
GVELTGAPVVRA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggcagggcactgatcatcgttgacgtgcagaacgacttctgcgaaggcggctcgctg
gcggtcgccggcggcgccgacgtggcctcggccatctcccggtacctgcaggagcacggc
gacgcctacgaccacgtcgtggcgacgcgggacttccacctggacccgggcgaccacttc
gccgacgagcccgactacgtcgactcctggccgccgcactgcgtgatcgggacgccgggc
gccgacttccacccgaacctgtcgctggccccgatcgaggcggtcttcagcaagggccac
cacagcgcggcctacagcggtttcgagggcgccgccgacgacggcacctccctggccgac
tggctgcgcgcccgccgggtggaccaggtggacgtggtcggcatcgccaccgaccattgc
gtgcgggccaccgcgctggacgccgcccgcgccggtttccgcacccgggtgctgctggag
ctgaccgccggggtcgccgaggccaccaccgaacgggcgctggagcagttgcgcgccgag
ggcgtcgagctgaccggcgcccccgtggtgcgcgcctga

DBGET integrated database retrieval system