KEGG   Thermomonospora curvata: Tcur_3938Help
Entry
Tcur_3938         CDS       T01127                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tcu  Thermomonospora curvata
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tcur_3938
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tcur_3938
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tcur_3938
Enzymes [BR:tcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tcur_3938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4482699..4483757)
Genome map
AA seq 352 aa AA seqDB search
MNRAWRGLIAEYRDRLPVTEATPVVTLLEGGTPLLPAQRISQLTGCEVYLKVEGANPTGS
FKDRGMTVAISKAAEEGAKAVICASTGNTSASAAAYAVRAGMTCAVLVPKGKIAMGKLAQ
ALVHGARLLQVDGNFDDCLELARKLAVDYPVALVNSVNKFRLQGQKTAAFEIVDALGDAP
DVHCLPVGNAGNISAYWMGYTEYAADKVATKTPRMLGFQASGAAPFVKGEPVRSPQTIAT
AIRIGNPASWDLAIAARDESGGAISAVTDRQILAAYRLLAREEGVFVEPASAASVAGVLQ
AREQGLIEAGERVVCTVTGNGLKDPDWAISGAPAPITVKVDAHAAASALGLT
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaacagggcttggcgcggcctcatcgccgagtaccgcgaccggctcccggtgaccgag
gccactcccgtcgtcaccctgctcgaaggcggcacgccgctgctgccggcacagcggatc
tcccagctcaccggctgcgaggtctacctgaaggtggagggcgccaaccccaccggctcg
ttcaaggaccgcggcatgaccgtggcgatcagcaaggccgccgaggagggcgccaaggcg
gtgatctgcgcctccaccggcaacacctccgcctcggccgccgcctatgcggtgcgggcc
ggcatgacgtgcgcggtgctggtgcccaagggcaagatcgccatgggcaagctggcgcag
gcgctggtgcacggcgcccggctgctgcaggtggacggcaacttcgacgactgcctggag
ctggcccgcaagctcgccgtggactacccggtcgccctggtcaactcggtcaacaagttc
cgcctgcagggccagaagaccgccgcgttcgagatcgtggacgctctcggcgacgccccc
gacgtgcactgcctgcccgtcggcaacgccgggaacatctccgcctactggatgggctac
accgagtacgccgccgacaaggtggccaccaagaccccgcgcatgctgggcttccaggcc
agcggggcggccccgttcgtcaagggcgagccggtgcgcagcccgcagacgatcgccacc
gccatccggatcggcaacccggcctcctgggatctggcgatcgccgcgcgcgacgagtcc
ggcggggccatctccgcggtcaccgaccggcagatcctggccgcctaccggctgctggcc
cgcgaggagggcgtgttcgtcgagcccgcctccgccgccagcgtcgccggcgtgctgcag
gcccgggagcaggggctgatcgaggcgggcgagcgggtggtctgcacggtgaccggcaac
ggcctgaaagaccccgactgggcgatctccggggcgcccgcgcccatcaccgtcaaggtc
gacgcccacgccgcggcgtccgcgctgggcctcacgtga

DBGET integrated database retrieval system