KEGG   Thermomonospora curvata: Tcur_4025Help
Entry
Tcur_4025         CDS       T01127                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tcu  Thermomonospora curvata
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tcur_4025
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Tcur_4025
Enzymes [BR:tcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Tcur_4025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4597117..4598748)
Genome map
AA seq 543 aa AA seqDB search
MRAKRSLALGAAALMLSLAGCSGAGTGKAVPENAGEATTAAPSADRTAWVFDVVAKMSLE
EKVGQLFVPTFASRQDAEQKIKKYHVGGLIYFPDNARSPQQTARLSNALQRASKIPLLLA
VDEEQGLVTRLSYVTRFPGNMALGATAKPQTAREAAKVIGTELRAVGINQNYAPVADVNV
NPANPVIGVRSFGSDPGLVSLMLGGALQGYRDAGVAATVKHFPGHGDTDTDSHTGLPVIR
HSRAEWERLDAPPFRAAIAQGVDAIMTAHIVMPGLDDSGDPATLSQAVLTGLLRKELGYR
GVVVTDSLSMAGARTRYGAEQAAVRAVQAGADQLLMPPDLAGAHAAVLAAVRDGRISQRR
LEESVTRILRLKAERGLFGDVQVDPARAGQVIGSAAHRAVARRVAEQSITLVRNRGGLLP
LAGRRVHVTGPHAQALAAALRRRGVETAASPAAADVTVLTAVDGGSGVAAQVAALAGRPL
VFAALGSPYDLAYATRAQAALAAYSSSAPSLEALAEVMTGRVKPTGRLPVEVRGYRFGHG
LTF
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcaaagcgctcgctggcgctgggcgcggcggcgctgatgctgtcgctggccgga
tgcagcggagcgggaacgggaaaggccgtgccggagaacgccggggaggcgaccaccgcc
gcgccgagcgcggaccggaccgcctgggtcttcgacgtcgtcgcgaagatgagcctggag
gagaaggtcggccagctgttcgtgcccaccttcgccagccggcaggacgccgagcagaag
atcaagaaataccacgtcggcgggctcatctacttccccgacaacgcccgcagcccacag
cagacggcccggctgtccaacgccctgcagcgggcctccaagatcccgctgctgctcgcc
gtggacgaagaacagggcctggtcaccaggctgtcgtatgtgacccgcttccccggcaac
atggcgctgggcgccaccgccaaaccgcagaccgcccgcgaggccgccaaggtgatcggc
accgagctgcgggcggtggggatcaaccagaactacgccccggtcgccgacgtcaacgtc
aacccggccaacccggtgatcggcgtccgctccttcggctcggacccgggactggtgtcg
ctgatgctgggcggcgccctgcaggggtaccgggacgcgggcgtggccgccaccgtcaag
cacttccccggccacggcgacaccgacaccgacagccacaccgggctgccggtgatcagg
cactcgcgggccgagtgggagcgactggacgcgccgccgttccgggccgccatcgcccag
ggcgtggacgccatcatgaccgcgcacatcgtgatgcccgggctggacgactccggcgac
ccggcgaccttgtcgcaggcggtgctgaccgggctgctgcgcaaggagctgggctaccgg
ggcgtggtggtcaccgactccctgagcatggcgggcgcccgcacccggtacggagccgag
caggccgcggtgcgggccgtgcaggcgggcgccgaccagctgctcatgccgccggatctg
gcgggcgcgcacgccgcggtgctggcggcggtgcgcgacggccggatctcccagcggcgg
ctggaggagtcggtgacccgcatcctgcgcctgaaggccgagcgcgggctgttcggcgac
gtccaggtcgatcccgcccgggccgggcaggtcatcggctcggccgcgcaccgggcggtg
gcccgccgggtcgccgagcagtcgatcacgctggtgcgcaaccggggcggcctgctgccg
ctggccggcaggcgggtgcacgtcaccggcccgcacgcccaggccctggcggcggcgctg
cgcaggcggggagtggagacggccgcctccccggccgcggccgatgtgacggtgctgacc
gcggtggacggcggatcgggcgtcgccgctcaggtcgccgcgctggcgggccggccgctg
gtgttcgcggcgctgggcagcccttatgacctggcgtatgcgacccgggcccaggcggcg
ctggccgcctactcctcgagcgcgccgtccctggaggcgctggcggaggtgatgaccggc
cgggtgaagcccaccggcaggctcccggtggaggtgcgcggctaccgattcgggcacggc
ctgaccttctga

DBGET integrated database retrieval system