KEGG   Thermomonospora curvata: Tcur_4189Help
Entry
Tcur_4189         CDS       T01127                                 

Definition
(GenBank) pyrimidine-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00240  Pyrimidine metabolism
tcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tcur_4189
Enzymes [BR:tcu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Tcur_4189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ACY99716
UniProt: D1A263
Position
complement(4779909..4781183)
Genome map
AA seq 424 aa AA seqDB search
MDAIDVIVTKRDGHRLSPQQIDWVIDAYTRGEVADEQMAALAMAIVLNGMDRAEVTRWTE
AMIRSGERMDFSALDRPTTDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRASLTPEQMLSVLREVGAVVCAAGSGLAPADRKLYALRDVTGTVESIPLI
ASSIMSKKIAEGTGALVLDVKVGSGAFMKTVERARELAETMVAIGTDHGVKTVALLTAMD
RPLGRAVGNALEVAEAVEVLAGGGPPDVVELTLTLAREMLAAAGLDAADPADALADGSAM
DVWRRMIRAQGGDPDAPLPVARESHTLTAPASGVLTGLDAYAVGVAAWRLGAGRARKEDP
VSPGAGVVCHAAPGEEVRAGQPLLTLHTDEPARFERALQALDGAITIEPEGSPDLLPLVI
DRIA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtggacgccatcgacgtcatcgtgaccaaacgcgacggccaccggctgtcgccgcagcag
atcgactgggtcatcgacgcctacacccgcggtgaggtcgccgacgagcagatggccgcg
ctggccatggccatcgtgctcaacggcatggaccgcgccgaggtgacgcgctggaccgag
gccatgatccgctccggggagcgcatggacttctccgcgctggaccgtcccaccaccgac
aagcactccaccggcggggtgggcgacaagatcacgttgccgctggccccgctggtggcg
gcctgcggcgccgccgtcccgcaactgtcggggcggggcctgggccacaccggcggcacg
ctggacaagctggagtcgatccccggctggcgggcctcgctcacccccgagcagatgctg
agcgtgctgcgcgaggtcggcgcggtggtgtgcgccgccggcagcgggctggccccggcc
gaccgcaagctgtacgccctgcgcgatgtgaccggcacggtggagtcgatcccgctgatc
gcctcctccatcatgtccaagaagatcgccgagggcaccggcgcgctggtgctggacgtc
aaggtcggctccggggcgttcatgaagaccgtcgagcgcgcccgcgagctggccgagacc
atggtcgccatcggcaccgaccacggcgtcaagaccgtggcgctgctgaccgccatggac
cgcccgctgggccgcgcggtcggcaacgccctggaggtcgccgaggccgtggaggtgctg
gccggcggcggcccgcccgatgtggtcgagctgaccctcaccctggcccgcgagatgctc
gcggcggccgggctggacgccgccgaccccgccgacgccctcgccgacggctcggccatg
gacgtctggcggcgcatgatccgcgcccagggcggcgatccggatgccccgctgcccgtc
gcccgcgagtcgcacaccctcaccgcccccgcctccggcgtgctgaccgggctggacgcc
tacgcggtgggagtggccgcctggcggctgggcgccggccgggcccgcaaggaggacccg
gtctcacccggcgccggagtggtctgccacgccgcaccgggcgaggaggtcagggcggga
cagccgctgctgaccctgcacaccgacgaaccggcccgcttcgaacgcgccctgcaggcc
ctcgacggcgccatcacgatcgagcccgagggcagccccgacctgctgccgctggtgatc
gaccgcatcgcctga

DBGET integrated database retrieval system