KEGG   Thermomonospora curvata: Tcur_4231Help
Entry
Tcur_4231         CDS       T01127                                 

Definition
Tat (twin-arginine translocation) pathway signal sequence domain-containing protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tcu  Thermomonospora curvata
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tcur_4231
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Tcur_4231
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Tcur_4231
Enzymes [BR:tcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Tcur_4231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4829606..4831162
Genome map
AA seq 518 aa AA seqDB search
MTFDRRTVLRGGLLIGGGAMPAPLAAPTAPAAAAPALIRRGRPRLTHGVQSGDVTAGRAV
VWARADRPARMLVDISRRPDFRGFRTVRGPVLTPKTDLTGKVFLRGLPAGERICYRVRLA
DLDRHALLSAPVEGSFRTPSRHRRDIRFVWSGDLAGQGWGINPELGGFRIFTAMGALDPD
FFLCSGDWVYADGPLTETVALPDGRTWRNVVTEEKSRVAQTLADYRGQFRYNLEDACLRA
FNARVPMIYQWDDHEVVNNWYPGEILDDARYTEKRVDVLAARARRALMEYTPIAAQAPRG
GRIYRKISYGPLLDVFILDMRTYKNPNTPNTSPTETGGVLGAEQLAWLKRELRRSTATWK
VMAADLPLGLVVPDGTAQEGIAQGDDGAPLGREREIAELLSHAQRHKVRNMVWLTADVHY
TAAHYYDPAKAAFTRFDPFWEFVSGPLNAGGFGPNRLEGTFGPQVKFFKAPPRANASPAE
GYQFFGQVDIDARSGVMTVRLRDLDGTVLYTQALSPVR
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgaccggcgaaccgtactgcgcggcgggctgctcatcggcggaggcgcgatg
ccggccccgctggccgcgccgaccgcgcccgccgccgcggcccccgcgctgatccggcgg
gggcggccgcgtctgacccacggcgtgcaaagcggcgatgtgaccgccgggcgggccgtg
gtgtgggcgcgcgccgaccgcccggcgcggatgctcgtcgacatcagccgccgccccgac
ttccggggtttccggaccgtccgcggcccggtgctgacgcccaagaccgatctgaccggc
aaggtgttcctgcgcgggctgccggccggggagcggatctgctaccgggtgcgccttgcc
gacctggaccggcacgcgctgctgtccgcccccgtcgaggggtctttccgcaccccttcc
cggcaccgccgcgacatccggttcgtgtggtccggcgacctggccggacagggctggggc
atcaatcccgagctgggcggctttcggatcttcaccgcgatgggcgcgctcgacccggac
ttctttttgtgcagcggcgactgggtgtacgccgacgggccgctcaccgagaccgtggcg
ctgccggacggccgcacctggcgcaacgtggtgaccgaggagaagagcagggtcgcccag
acgctggccgactaccgcgggcagttccgctacaacttggaggacgcctgcctgcgagcc
ttcaacgcccgcgtcccgatgatctaccagtgggacgatcacgaggtcgtcaacaactgg
tacccgggggagatcctcgacgatgcccgctacaccgaaaagcgcgtggacgtgctggcc
gcccgggcccgccgcgccctgatggagtacaccccgatcgccgcccaggcgccccggggc
ggccggatctaccgcaagatctcctacggtccgctgctggatgtcttcatcctggacatg
cggacctacaagaaccccaacacccccaacacctcccccaccgagaccgggggcgtgctg
ggcgccgagcagctggcctggctcaagcgggagctgcgccgctccacggcgacctggaag
gtgatggccgccgacctgccgctcgggctggtcgtgccggacggcaccgcccaggagggc
atcgcccagggcgacgacggggcgccgctgggccgcgagcgggagatcgccgagctgctc
tcccatgcccagcggcacaaggtccgcaacatggtgtggctgaccgccgacgtgcactac
accgcggcccactactacgaccccgccaaggcggccttcaccaggttcgacccgttctgg
gagttcgtctccggcccgttgaacgccggtggtttcggccccaaccgcctggagggcacc
ttcggcccccaggtgaagttcttcaaggccccgccgcgcgccaacgcctcccccgccgag
ggctaccagttcttcgggcaggtggacatcgacgcccgcagcggggtgatgaccgtccgg
ctgcgggacctcgacggcaccgtcctttacacgcaggccctgtcgcccgtgcgctga

DBGET integrated database retrieval system