KEGG   Thermomonospora curvata: Tcur_4231Help
Entry
Tcur_4231         CDS       T01127                                 

Definition
Tat (twin-arginine translocation) pathway signal sequence domain-containing protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tcu  Thermomonospora curvata
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tcu00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:tcu00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:tcu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4829606..4831162
Genome map
AA seq 518 aa AA seqDB search
MTFDRRTVLRGGLLIGGGAMPAPLAAPTAPAAAAPALIRRGRPRLTHGVQSGDVTAGRAV
VWARADRPARMLVDISRRPDFRGFRTVRGPVLTPKTDLTGKVFLRGLPAGERICYRVRLA
DLDRHALLSAPVEGSFRTPSRHRRDIRFVWSGDLAGQGWGINPELGGFRIFTAMGALDPD
FFLCSGDWVYADGPLTETVALPDGRTWRNVVTEEKSRVAQTLADYRGQFRYNLEDACLRA
FNARVPMIYQWDDHEVVNNWYPGEILDDARYTEKRVDVLAARARRALMEYTPIAAQAPRG
GRIYRKISYGPLLDVFILDMRTYKNPNTPNTSPTETGGVLGAEQLAWLKRELRRSTATWK
VMAADLPLGLVVPDGTAQEGIAQGDDGAPLGREREIAELLSHAQRHKVRNMVWLTADVHY
TAAHYYDPAKAAFTRFDPFWEFVSGPLNAGGFGPNRLEGTFGPQVKFFKAPPRANASPAE
GYQFFGQVDIDARSGVMTVRLRDLDGTVLYTQALSPVR
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgaccggcgaaccgtactgcgcggcgggctgctcatcggcggaggcgcgatg
ccggccccgctggccgcgccgaccgcgcccgccgccgcggcccccgcgctgatccggcgg
gggcggccgcgtctgacccacggcgtgcaaagcggcgatgtgaccgccgggcgggccgtg
gtgtgggcgcgcgccgaccgcccggcgcggatgctcgtcgacatcagccgccgccccgac
ttccggggtttccggaccgtccgcggcccggtgctgacgcccaagaccgatctgaccggc
aaggtgttcctgcgcgggctgccggccggggagcggatctgctaccgggtgcgccttgcc
gacctggaccggcacgcgctgctgtccgcccccgtcgaggggtctttccgcaccccttcc
cggcaccgccgcgacatccggttcgtgtggtccggcgacctggccggacagggctggggc
atcaatcccgagctgggcggctttcggatcttcaccgcgatgggcgcgctcgacccggac
ttctttttgtgcagcggcgactgggtgtacgccgacgggccgctcaccgagaccgtggcg
ctgccggacggccgcacctggcgcaacgtggtgaccgaggagaagagcagggtcgcccag
acgctggccgactaccgcgggcagttccgctacaacttggaggacgcctgcctgcgagcc
ttcaacgcccgcgtcccgatgatctaccagtgggacgatcacgaggtcgtcaacaactgg
tacccgggggagatcctcgacgatgcccgctacaccgaaaagcgcgtggacgtgctggcc
gcccgggcccgccgcgccctgatggagtacaccccgatcgccgcccaggcgccccggggc
ggccggatctaccgcaagatctcctacggtccgctgctggatgtcttcatcctggacatg
cggacctacaagaaccccaacacccccaacacctcccccaccgagaccgggggcgtgctg
ggcgccgagcagctggcctggctcaagcgggagctgcgccgctccacggcgacctggaag
gtgatggccgccgacctgccgctcgggctggtcgtgccggacggcaccgcccaggagggc
atcgcccagggcgacgacggggcgccgctgggccgcgagcgggagatcgccgagctgctc
tcccatgcccagcggcacaaggtccgcaacatggtgtggctgaccgccgacgtgcactac
accgcggcccactactacgaccccgccaaggcggccttcaccaggttcgacccgttctgg
gagttcgtctccggcccgttgaacgccggtggtttcggccccaaccgcctggagggcacc
ttcggcccccaggtgaagttcttcaaggccccgccgcgcgccaacgcctcccccgccgag
ggctaccagttcttcgggcaggtggacatcgacgcccgcagcggggtgatgaccgtccgg
ctgcgggacctcgacggcaccgtcctttacacgcaggccctgtcgcccgtgcgctga

DBGET integrated database retrieval system