KEGG   Thermomonospora curvata: Tcur_4438Help
Entry
Tcur_4438         CDS       T01127                                 

Definition
uroporphyrin-III C/tetrapyrrole methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
tcu  Thermomonospora curvata
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tcur_4438
Enzymes [BR:tcu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Tcur_4438
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Tcur_4438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5039141..5040721)
Genome map
AA seq 526 aa AA seqDB search
MNPANRNTEGNAPAEVSFVGMGPGDPGLLTLRAVDKLRQADTVVVDRAICPAEVLAHCRP
DAEILDVADGDPVRLVGEAAKAGRTVVRLLRGDPVLGGSLAEEAAMCAKDGIPFEIVSGV
SSVTGVPGYAGIPLTDSRTREVRVIDASRGGVDWEEFSSPDATLVILGAEGMVAEVAKGL
MAAGRPESTPAAMTSMGTTTEQETVVTTLQRLVPDTKGMESPAMIIVGDVVGWRERLSWF
ETKPLFGWRVLVPRTKEQAASLSERLRSYGAVPEEVPTISVEPPRTPQQMDRAVKGLVTG
RYEWVVFTSTNAVRAIKEKFDDYGLDARAFAGLKVAAVGEQTAKALMEFGVTPDLVPTGQ
QSGEGLVEVWPPYDKDLDPINRVLLPRADIATDTLIAGLTELGWECDDVTAYRTVRAAPP
PAPIREAIKGGGFDAVLFTSSSTVRNLIGIAGKPHNVTVIAVIGPQTAKTAQEYGLRVDV
MAAKPSALELADALAEYGAKRRAAQIEAGEPLRKPSQMRRGARRRR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccccgctaacaggaacaccgagggcaacgcaccggccgaggtctcgttcgtggga
atgggaccgggcgacccgggactgctgaccttgcgggccgtcgacaaactccgccaggcc
gacacggtggtggtggaccgggcgatctgccccgccgaggtgctggcgcactgccgtccg
gacgccgagatcctcgacgtcgccgacggcgacccggtcaggctggtcggcgaggccgcc
aaggccggacgcaccgtggtgcggctgctgcgcggcgacccggtgctgggcggctcgctg
gccgaggaggccgcgatgtgcgccaaggacgggatcccgttcgagatcgtctccggggtc
tcgtccgtcaccggcgtgccggggtatgccggcatcccgctgaccgactcgcgcacccgc
gaggtccgcgtgatcgacgcctcccgcggcggggtcgactgggaggagttctcctccccg
gacgccacgctggtgatcctgggcgccgagggcatggtggcggaggtggccaaaggcctg
atggccgccggccgcccggagtccaccccggccgccatgaccagcatgggcaccaccacc
gagcaggagaccgtggtcaccacgctgcagcgcctggtgcccgacaccaagggcatggag
tccccggcgatgatcatcgtaggggacgtggtgggctggcgggagcgactttcgtggttt
gagaccaagccgctgttcggctggcgggtgctggtgccgcgcaccaaggagcaggccgcc
tccctgtcggagcggctgcgctcttatggagcggtccccgaagaggtgccgaccatctcg
gtggagccgccgcgcaccccccagcagatggaccgggccgtcaagggcctggtcaccggc
cgctacgagtgggtggtgttcacctccaccaacgcggtgcgggcgatcaaggagaagttc
gacgactacggcctggacgcccgcgccttcgccgggctgaaggtcgccgcggtcggcgag
cagaccgccaaggcgctgatggagttcggggtcacccccgacctggtgcccaccggccag
cagtccggagagggcctggtggaggtctggccgccgtacgacaaggacctggacccgatc
aaccgggtgctgctgccgcgcgccgacatcgccaccgacaccctcatcgccgggctgacc
gagctgggctgggagtgcgacgacgtcaccgcctaccggacggtgcgggccgcgccgccg
ccggcgccgatccgcgaggccatcaagggcggcgggttcgacgcggtgctgttcacctcc
tcctccaccgtccgcaacctgatcggcatcgccggcaagccgcacaacgtcacggtgatc
gcggtgatcggcccgcagaccgccaagaccgcccaggagtacgggctgcgggtggacgtc
atggcggccaagccctcggccctggagctggccgacgcactggccgagtacggtgccaag
cgcagggccgcccagatcgaggcgggcgagccgctgcgcaagccgagccagatgcgccgc
ggcgcccgccggcgccgctga

DBGET integrated database retrieval system